2ZJU - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF LYMNAEA STAGNALIS ACETYLCHOLINE BINDING PROTEIN (LS-ACHBP) COMPLEXED WITH IMIDACLOPRID

Authors :   T. Okajima, M. Ihara, A. Yamashita, T. Oda, T. Morimoto, K. Matsuda

Date :   10 Mar 08 (Deposition) - 08 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.58

Chains :   Asym./Biol. Unit : A,B,C,D,E

Keywords :   Acetylcholine Binding Protein, Neonicotinoids, Nicotinic Acetylcholine Receptor, Imidacloprid, Cell Junction, Glycoprotein, Immunoglobulin Domain, Secreted, Synapse, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Ihara, T. Okajima, A. Yamashita, T. Oda, K. Hirata, H. Nishiwaki, T. Morimoto, M. Akamatsu, Y. Ashikawa, S. Kuroda, R. Mega, S. Kuramitsu, D. B. Sattelle, K. Matsuda
Crystal Structures Of Lymnaea Stagnalis Achbp In Complex With Neonicotinoid Insecticides Imidacloprid And Clothianidin
Invert. Neurosci. V. 8 71 2008
PubMed-ID: 18338186 | Reference-DOI: 10.1007/S10158-008-0069-3
(for further references see the PDB file header)

Molecule 1 - ACETYLCHOLINE-BINDING PROTEIN
	Chains	:	A, B, C, D, E
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Common	:	FUNGI
	Expression System Plasmid	:	PPICZB
	Expression System Strain	:	X-33
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 16-229
	Mutation	:	YES
	Organism Common	:	GREAT POND SNAIL
	Organism Scientific	:	LYMNAEA STAGNALIS
	Synonym	:	ACH-BINDING PROTEIN, ACHBP

		1	2	3	4	5
Asymmetric/Biological Unit	:	A	B	C	D	E

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 5)

No.	Name	Count	Type	Full Name
1	IM4	5	Ligand/Ion	(2E)-1-[(6-CHLOROPYRIDIN-3-YL)METHYL]-N-NITROIMIDAZOLIDIN-2-IMINE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TRP A:143 , TYR A:185 , CYS A:187 , TYR A:192 , TRP B:53 , GLN B:55 , ARG B:104 , LEU B:112 , MET B:114	BINDING SITE FOR RESIDUE IM4 A 301
2	AC2	SOFTWARE	TRP B:143 , TYR B:185 , CYS B:187 , TYR B:192 , TRP C:53 , ARG C:104 , LEU C:112 , MET C:114	BINDING SITE FOR RESIDUE IM4 C 301
3	AC3	SOFTWARE	TRP C:143 , THR C:144 , TYR C:185 , CYS C:187 , TYR C:192 , TRP D:53 , GLN D:55 , ARG D:104 , LEU D:112 , TYR D:113 , MET D:114	BINDING SITE FOR RESIDUE IM4 D 301
4	AC4	SOFTWARE	TRP D:143 , TYR D:185 , CYS D:187 , TYR D:192 , TRP E:53 , LEU E:102 , ARG E:104 , LEU E:112 , TYR E:113 , MET E:114	BINDING SITE FOR RESIDUE IM4 D 302
5	AC5	SOFTWARE	TRP A:53 , ARG A:104 , LEU A:112 , TYR A:113 , MET A:114 , TRP E:143 , THR E:144 , TYR E:185 , CYS E:187 , CYS E:188 , TYR E:192	BINDING SITE FOR RESIDUE IM4 E 301

Asymmetric/Biological Unit

No.	Residues
1	A:123	-	A:136
2	A:187	-	A:188
3	B:123	-	B:136
4	B:187	-	B:188
5	C:123	-	C:136
6	C:187	-	C:188
7	D:123	-	D:136
8	D:187	-	D:188
9	E:123	-	E:136
10	E:187	-	E:188

(no "Cis Peptide Bond" information available for 2ZJU)

(no "SAP(SNP)/Variant" information available for 2ZJU)

(no "PROSITE Motif" information available for 2ZJU)

(no "Exon" information available for 2ZJU)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:207
 aligned with ACHP_LYMST | P58154 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:207
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       
           ACHP_LYMST    19 SLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR 225
               SCOP domains d2zjua_ A: automated matches                                                                                                                                                                                    SCOP domains
               CATH domains 2zjuA00 A:0-206  [code=2.70.170.10, no name defined]                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeee.................eeeeeeeeeeeeee......eeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zju A   0 AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR 206
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Chain B from PDB  Type:PROTEIN  Length:209
 aligned with ACHP_LYMST | P58154 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:209
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218         
           ACHP_LYMST    19 SLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSE 227
               SCOP domains d2zjub_ B: automated matches                                                                                                                                                                                      SCOP domains
               CATH domains 2zjuB00 B:0-208  [code=2.70.170.10, no name defined]                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeee.................eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zju B   0 AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSE 208
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Chain C from PDB  Type:PROTEIN  Length:208
 aligned with ACHP_LYMST | P58154 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:208
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218        
           ACHP_LYMST    19 SLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 226
               SCOP domains d2zjuc_ C: automated matches                                                                                                                                                                                     SCOP domains
               CATH domains 2zjuC00 C:0-207  [code=2.70.170.10, no name defined]                                                                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeee.................eeeeeeeeeeeeee......eeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zju C   0 AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 207
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Chain D from PDB  Type:PROTEIN  Length:208
 aligned with ACHP_LYMST | P58154 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:208
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218        
           ACHP_LYMST    19 SLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 226
               SCOP domains d2zjud_ D: automated matches                                                                                                                                                                                     SCOP domains
               CATH domains 2zjuD00 D:0-207  [code=2.70.170.10, no name defined]                                                                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeee.................eeeeeeeeeeeeeee..eeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zju D   0 AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 207
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Chain E from PDB  Type:PROTEIN  Length:208
 aligned with ACHP_LYMST | P58154 from UniProtKB/Swiss-Prot  Length:229

    Alignment length:208
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218        
           ACHP_LYMST    19 SLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 226
               SCOP domains d2zjue_ E: automated matches                                                                                                                                                                                     SCOP domains
               CATH domains 2zjuE00 E:0-207  [code=2.70.170.10, no name defined]                                                                                                                                                             CATH domains
           Pfam domains (1) ---Neur_chan_LBD-2zjuE01 E:3-205                                                                                                                                                                              -- Pfam domains (1)
           Pfam domains (2) ---Neur_chan_LBD-2zjuE02 E:3-205                                                                                                                                                                              -- Pfam domains (2)
           Pfam domains (3) ---Neur_chan_LBD-2zjuE03 E:3-205                                                                                                                                                                              -- Pfam domains (3)
           Pfam domains (4) ---Neur_chan_LBD-2zjuE04 E:3-205                                                                                                                                                                              -- Pfam domains (4)
           Pfam domains (5) ---Neur_chan_LBD-2zjuE05 E:3-205                                                                                                                                                                              -- Pfam domains (5)
         Sec.struct. author ..hhhhhhhhhhhhh............eeeeeeeeeeeeeeee....eeeeeeeeeeeee.hhhh........eeeee.hhh....eee.......ee....eeeee...eeee..eeeeeee...........eeeeeeeee.......eeeee................eeeeeeeeeeeeee......eeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zju E   0 AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS 207
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Nicotinic receptor ligand binding domain-like (58)

Superfamily: Nicotinic receptor ligand binding domain-like (58)

Family: Nicotinic receptor ligand binding domain-like (18)

Protein domain: automated matches (11)

Great pond snail (Lymnaea stagnalis) [TaxId: 6523] (9)

1a	d2zjua_	A:
1b	d2zjub_	B:
1c	d2zjuc_	C:
1d	d2zjud_	D:
1e	d2zjue_	E:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Distorted Sandwich (506)

Topology: Acetylcholine Binding Protein; Chain: A, (12)

Homologous Superfamily: [code=2.70.170.10, no name defined] (12)

Great pond snail (Lymnaea stagnalis) (6)

1a	2zjuA00	A:0-206
1b	2zjuC00	C:0-207
1c	2zjuD00	D:0-207
1d	2zjuE00	E:0-207
1e	2zjuB00	B:0-208

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Neur_chan_LBD] (30)

Family: Neur_chan_LBD (30)

Lymnaea stagnalis (Great pond snail) (5)

1a	Neur_chan_LBD-2zjuE01	E:3-205
1b	Neur_chan_LBD-2zjuE02	E:3-205
1c	Neur_chan_LBD-2zjuE03	E:3-205
1d	Neur_chan_LBD-2zjuE04	E:3-205
1e	Neur_chan_LBD-2zjuE05	E:3-205

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E (ACHP_LYMST | P58154)

molecular function
	GO:0005230	extracellular ligand-gated ion channel activity	Enables the transmembrane transfer of an ion by a channel that opens when a specific extracellular ligand has been bound by the channel complex or one of its constituent parts.
biological process
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		IM4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2zju)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2zju
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACHP_LYMST \| P58154
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACHP_LYMST \| P58154
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 5)

Sites (5, 5)

SS Bonds (10, 10)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (1, 5)

Pfam Domains (1, 5)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File