2Z5F - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   HUMAN SULFOTRANSFERASE SULT1B1 IN COMPLEX WITH PAP

Authors :   L. Dombrovski, T. Pegasova, H. Wu, P. Loppnau, A. M. Edwards, C. H. Arrowsmith, M. Sundstrom, A. N. Plotnikov, A. Bochkarev, Structural Genomics Consortium (Sgc)

Date :   07 Jul 07 (Deposition) - 14 Aug 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B

Keywords :   Sult, Sulfotransferase, Pap, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Dombrovski, A. Dong, A. Bochkarev, A. N. Plotnikov
Crystal Structures Of Human Sulfotransferases Sult1B1 And Sult1C1 Complexed With The Cofactor Product Adenosine-3'-5'-Diphosphate (Pap)
Proteins V. 64 1091 2006
PubMed-ID: 16804942 | Reference-DOI: 10.1002/PROT.21048
(for further references see the PDB file header)

Molecule 1 - SULFOTRANSFERASE FAMILY CYTOSOLIC 1B MEMBER 1
	Chains	:	A, B
	EC Number	:	2.8.2.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A-LIC
	Expression System Strain	:	BL21(DE3) CODON PLUS RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SULT1B1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SULFOTRANSFERASE 1B2, THYROID HORMONE SULFOTRANSFERASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

(no "Site" information available for 2Z5F)

(no "SS Bond" information available for 2Z5F)

Asymmetric/Biological Unit

No.	Residues
1	Ser A:102	-	Pro A:103
2	Ser B:102	-	Pro B:103

(no "SAP(SNP)/Variant" information available for 2Z5F)

(no "PROSITE Motif" information available for 2Z5F)

Asymmetric/Biological Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000310613	3a	ENSE00001180398	chr4:70626430-70626177	254	ST1B1_HUMAN	-	0	0	-	-
1.5a	ENST00000310613	5a	ENSE00001180407	chr4:70620979-70620788	192	ST1B1_HUMAN	1-50	50	2	A:4-50 B:4-50	47 47
1.6	ENST00000310613	6	ENSE00002155316	chr4:70620516-70620388	129	ST1B1_HUMAN	50-93	44	2	A:50-93 B:50-93	44 44
1.7	ENST00000310613	7	ENSE00001180389	chr4:70615536-70615439	98	ST1B1_HUMAN	93-125	33	2	A:93-125 B:93-125	33 33
1.8b	ENST00000310613	8b	ENSE00001180385	chr4:70599982-70599856	127	ST1B1_HUMAN	126-168	43	2	A:126-168 B:126-168	43 43
1.9	ENST00000310613	9	ENSE00001180380	chr4:70599225-70599131	95	ST1B1_HUMAN	168-199	32	2	A:168-199 B:168-199	32 32
1.10	ENST00000310613	10	ENSE00001180373	chr4:70596399-70596219	181	ST1B1_HUMAN	200-260	61	2	A:200-260 B:200-260	61 61
1.11	ENST00000310613	11	ENSE00001239171	chr4:70592918-70592566	353	ST1B1_HUMAN	260-296	37	2	A:260-296 B:260-296	37 37

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:293
 aligned with ST1B1_HUMAN | O43704 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:293
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293   
          ST1B1_HUMAN     4 PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
               SCOP domains d2z5fa_ A: Thyroid hormone sulfotransferase Sult1b1                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 2z5fA00 A:4-296 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eee..eeehhhhh.hhhhhhh.......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh............hhhhhhh......eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..........................hhhhhh.hhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:4-50 UniProt: 1-50           ------------------------------------------Exon 1.7  PDB: A:93-125          Exon 1.8b  PDB: A:126-168 UniProt: 126-168 -------------------------------Exon 1.10  PDB: A:200-260 UniProt: 200-260                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.6  PDB: A:50-93 UniProt: 50-93       --------------------------------------------------------------------------Exon 1.9  PDB: A:168-199        ------------------------------------------------------------Exon 1.11  PDB: A:260-296             Transcript 1 (2)
                 2z5f A   4 PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293

Chain B from PDB  Type:PROTEIN  Length:293
 aligned with ST1B1_HUMAN | O43704 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:293
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293   
          ST1B1_HUMAN     4 PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
               SCOP domains d2z5fb_ B: Thyroid hormone sulfotransferase Sult1b1                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 2z5fB00 B:4-296 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                                  CATH domains
           Pfam domains (1) ----------------------------------Sulfotransfer_1-2z5fB01 B:38-289                                                                                                                                                                                                                            ------- Pfam domains (1)
           Pfam domains (2) ----------------------------------Sulfotransfer_1-2z5fB02 B:38-289                                                                                                                                                                                                                            ------- Pfam domains (2)
         Sec.struct. author .........eee..eee......hhhhhhh.......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh............hhhhhhh......eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...........................hhhhhh.hhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: B:4-50 UniProt: 1-50           ------------------------------------------Exon 1.7  PDB: B:93-125          Exon 1.8b  PDB: B:126-168 UniProt: 126-168 -------------------------------Exon 1.10  PDB: B:200-260 UniProt: 200-260                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.6  PDB: B:50-93 UniProt: 50-93       --------------------------------------------------------------------------Exon 1.9  PDB: B:168-199        ------------------------------------------------------------Exon 1.11  PDB: B:260-296             Transcript 1 (2)
                 2z5f B   4 PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: PAPS sulfotransferase (54)

Protein domain: Thyroid hormone sulfotransferase Sult1b1 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d2z5fa_	A:
1b	d2z5fb_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	2z5fA00	A:4-296
1b	2z5fB00	B:4-296

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: Sulfotransfer_1 (24)

Homo sapiens (Human) (16)

1a	Sulfotransfer_1-2z5fB01	B:38-289
1b	Sulfotransfer_1-2z5fB02	B:38-289

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ST1B1_HUMAN | O43704)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0006576	cellular biogenic amine metabolic process	The chemical reactions and pathways occurring at the level of individual cells involving any of a group of naturally occurring, biologically active amines, such as norepinephrine, histamine, and serotonin, many of which act as neurotransmitters.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0009812	flavonoid metabolic process	The chemical reactions and pathways involving flavonoids, a group of water-soluble phenolic derivatives containing a flavan skeleton including flavones, flavonols and flavanoids, and anthocyanins.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0018958	phenol-containing compound metabolic process	The chemical reactions and pathways involving a phenol, any compound containing one or more hydroxyl groups directly attached to an aromatic carbon ring.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
	GO:0042403	thyroid hormone metabolic process	The chemical reactions and pathways involving any of the compounds secreted by the thyroid gland, largely thyroxine and triiodothyronine.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2z5f)

	Cis Peptide Bonds
		Ser A:102 - Pro A:103	[ RasMol ]
		Ser B:102 - Pro B:103	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2z5f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1B1_HUMAN \| O43704
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST1B1_HUMAN \| O43704
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ST1B1_HUMAN \| O43704	:	3ckl

(no "Related Entries Specified in the PDB File" available for 2Z5F)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File