Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE HETEROTRIMERIC LKB1-STRADALPHA-MO25ALPHA COMPLEX
 
Authors :  E. Zeqiraj, D. M. F. Van Aalten
Date :  16 Sep 09  (Deposition) - 15 Dec 09  (Release) - 02 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  D,E,F  (1x)
Biol. Unit 2:  A,B,C  (1x)
Keywords :  Transferase-Metal-Binding Protein Complex, Transferase Metal-Binding Protein Complex, Kinase, Nucleus, Serine/Threonine-Protein Kinase, Pseudokinase, Phosphoprotein, Signal Transduction, Transferase, Nucleotide-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Zeqiraj, B. M. Filippi, M. Deak, D. R. Alessi, D. M. F. Van Aalten
Structure Of The Lkb1-Strad-Mo25 Complex Reveals An Allosteric Mechanism Of Kinase Activation.
Science V. 326 1707 2009
PubMed-ID: 19892943  |  Reference-DOI: 10.1126/SCIENCE.1178377

(-) Compounds

Molecule 1 - CALCIUM-BINDING PROTEIN 39
    ChainsA, D
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidMULTIBAC
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMO25ALPHA, PROTEIN MO25
 
Molecule 2 - STE20-RELATED KINASE ADAPTER PROTEIN ALPHA
    ChainsB, E
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidMULTIBAC
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentPSEUDOKINASE DOMAIN, RESIDUES 59-431
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSTRADALPHA, STRAD ALPHA, STE20-RELATED ADAPTER PROTEIN, SEROLOGICALLY DEFINED BREAST CANCER ANTIGEN NY-BR-96
 
Molecule 3 - SERINE/THREONINE-PROTEIN KINASE 11
    ChainsC, F
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidMULTIBAC
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN, RESIDUES 43-347
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLKB1, SERINE/THREONINE-PROTEIN KINASE LKB1, RENAL CARCINOMA ANTIGEN NY-REN-19

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)   DEF
Biological Unit 2 (1x)ABC   

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
1ANP4Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2SO41Ligand/IonSULFATE ION
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
1ANP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2SO41Ligand/IonSULFATE ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1ANP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2SO4-1Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE B:75 , GLY B:76 , LYS B:77 , GLY B:78 , PHE B:79 , MET B:83 , VAL B:85 , THR B:98 , ARG B:100 , THR B:147 , SER B:148 , MET B:150 , SER B:154 , ASP B:157 , LYS B:197 , SER B:199 , HIS B:200 , ARG B:215 , LYS B:239BINDING SITE FOR RESIDUE ANP B 432
2AC2SOFTWAREGLY C:56 , GLY C:58 , SER C:59 , TYR C:60 , GLY C:61 , VAL C:63 , ALA C:76 , LYS C:78 , MET C:129 , GLU C:130 , CYS C:132 , GLU C:138 , LEU C:183BINDING SITE FOR RESIDUE ANP C 2
3AC3SOFTWAREARG D:152 , ARG D:194 , LYS F:108BINDING SITE FOR RESIDUE SO4 D 342
4AC4SOFTWAREILE E:75 , GLY E:76 , LYS E:77 , GLY E:78 , PHE E:79 , MET E:83 , VAL E:85 , THR E:98 , ARG E:100 , THR E:147 , SER E:148 , MET E:150 , SER E:154 , ASP E:157 , LYS E:197 , SER E:199 , HIS E:200 , ARG E:215 , LYS E:239 , PHE E:415BINDING SITE FOR RESIDUE ANP E 432
5AC5SOFTWAREGLY F:56 , GLY F:58 , SER F:59 , TYR F:60 , GLY F:61 , ALA F:76 , LYS F:78 , MET F:129 , GLU F:130 , CYS F:132 , GLU F:138 , LEU F:183BINDING SITE FOR RESIDUE ANP F 4

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WTK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2WTK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (43, 82)

Asymmetric Unit (43, 82)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_033138Y49DSTK11_HUMANUnclassified137853080C/FY49D
02UniProtVAR_041378S60ISTRAA_HUMANPolymorphism56271007ES60I
03UniProtVAR_041379P64SSTRAA_HUMANPolymorphism55695051B/EP64S
04UniProtVAR_065629V66MSTK11_HUMANUnclassified  ---C/FV66M
05UniProtVAR_006202L67PSTK11_HUMANDisease (PJS)137853077C/FL67P
06UniProtVAR_065630R86GSTK11_HUMANUnclassified  ---C/FR86G
07UniProtVAR_041139R87KSTK11_HUMANUnclassified  ---C/FR87K
08UniProtVAR_033139G135RSTK11_HUMANUnclassified137853081C/FG135R
09UniProtVAR_065632F157SSTK11_HUMANUnclassified  ---C/FF157S
10UniProtVAR_065633L160PSTK11_HUMANUnclassified  ---C/FL160P
11UniProtVAR_033140G163DSTK11_HUMANDisease (TGCT)137853078C/FG163D
12UniProtVAR_065634Q170PSTK11_HUMANUnclassified  ---C/FQ170P
13UniProtVAR_065635G171SSTK11_HUMANUnclassified  ---C/FG171S
14UniProtVAR_065636H174RSTK11_HUMANUnclassified  ---C/FH174R
15UniProtVAR_071058D176NSTK11_HUMANDisease (PJS)730881979C/FD176N
16UniProtVAR_065637D176YSTK11_HUMANUnclassified  ---C/FD176Y
17UniProtVAR_065638I177NSTK11_HUMANUnclassified  ---C/FI177N
18UniProtVAR_065639N181ESTK11_HUMANUnclassified  ---C/FN181E
19UniProtVAR_007921D194NSTK11_HUMANDisease (PJS)121913315C/FA194N
20UniProtVAR_065640D194VSTK11_HUMANUnclassified121913316C/FA194V
21UniProtVAR_033141D194YSTK11_HUMANUnclassified121913315C/FA194Y
22UniProtVAR_065641E199KSTK11_HUMANUnclassified121913317C/FE199K
23UniProtVAR_065642E199QSTK11_HUMANUnclassified  ---C/FE199Q
24UniProtVAR_065643A205TSTK11_HUMANUnclassified730881981C/FA205T
25UniProtVAR_065644D208NSTK11_HUMANUnclassified  ---C/FD208N
26UniProtVAR_065645G215DSTK11_HUMANUnclassified  ---C/FG215D
27UniProtVAR_065646S216FSTK11_HUMANUnclassified  ---C/FS216F
28UniProtVAR_065647E223VSTK11_HUMANUnclassified  ---C/FE223V
29UniProtVAR_065648T230PSTK11_HUMANUnclassified  ---C/FT230P
30UniProtVAR_065649F231LSTK11_HUMANUnclassified  ---C/FF231L
31UniProtVAR_065650S232PSTK11_HUMANUnclassified  ---C/FS232P
32UniProtVAR_033142W239CSTK11_HUMANDisease (PJS)137853082C/FW239C
33UniProtVAR_065651L245RSTK11_HUMANUnclassified  ---C/FL245R
34UniProtVAR_065652T250PSTK11_HUMANUnclassified  ---C/FT250P
35UniProtVAR_065653Y272HSTK11_HUMANUnclassified  ---CY272H
36UniProtVAR_065654D277YSTK11_HUMANUnclassified  ---CD277Y
37UniProtVAR_065655P281LSTK11_HUMANUnclassified121913322CP281L
38UniProtVAR_065656L285QSTK11_HUMANUnclassified  ---C/FL285Q
39UniProtVAR_007922R297KSTK11_HUMANDisease (PJS)  ---C/FR297K
40UniProtVAR_071059W308CSTK11_HUMANDisease (PJS)  ---C/FW308C
41UniProtVAR_065657P314HSTK11_HUMANUnclassified  ---C/FP314H
42UniProtVAR_033144P315SSTK11_HUMANDisease (PJS)786202431C/FP315S
43UniProtVAR_065658P324LSTK11_HUMANUnclassified367807476C/FP324L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (40, 40)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_033138Y49DSTK11_HUMANUnclassified137853080FY49D
02UniProtVAR_041378S60ISTRAA_HUMANPolymorphism56271007ES60I
03UniProtVAR_041379P64SSTRAA_HUMANPolymorphism55695051EP64S
04UniProtVAR_065629V66MSTK11_HUMANUnclassified  ---FV66M
05UniProtVAR_006202L67PSTK11_HUMANDisease (PJS)137853077FL67P
06UniProtVAR_065630R86GSTK11_HUMANUnclassified  ---FR86G
07UniProtVAR_041139R87KSTK11_HUMANUnclassified  ---FR87K
08UniProtVAR_033139G135RSTK11_HUMANUnclassified137853081FG135R
09UniProtVAR_065632F157SSTK11_HUMANUnclassified  ---FF157S
10UniProtVAR_065633L160PSTK11_HUMANUnclassified  ---FL160P
11UniProtVAR_033140G163DSTK11_HUMANDisease (TGCT)137853078FG163D
12UniProtVAR_065634Q170PSTK11_HUMANUnclassified  ---FQ170P
13UniProtVAR_065635G171SSTK11_HUMANUnclassified  ---FG171S
14UniProtVAR_065636H174RSTK11_HUMANUnclassified  ---FH174R
15UniProtVAR_071058D176NSTK11_HUMANDisease (PJS)730881979FD176N
16UniProtVAR_065637D176YSTK11_HUMANUnclassified  ---FD176Y
17UniProtVAR_065638I177NSTK11_HUMANUnclassified  ---FI177N
18UniProtVAR_065639N181ESTK11_HUMANUnclassified  ---FN181E
19UniProtVAR_007921D194NSTK11_HUMANDisease (PJS)121913315FA194N
20UniProtVAR_065640D194VSTK11_HUMANUnclassified121913316FA194V
21UniProtVAR_033141D194YSTK11_HUMANUnclassified121913315FA194Y
22UniProtVAR_065641E199KSTK11_HUMANUnclassified121913317FE199K
23UniProtVAR_065642E199QSTK11_HUMANUnclassified  ---FE199Q
24UniProtVAR_065643A205TSTK11_HUMANUnclassified730881981FA205T
25UniProtVAR_065644D208NSTK11_HUMANUnclassified  ---FD208N
26UniProtVAR_065645G215DSTK11_HUMANUnclassified  ---FG215D
27UniProtVAR_065646S216FSTK11_HUMANUnclassified  ---FS216F
28UniProtVAR_065647E223VSTK11_HUMANUnclassified  ---FE223V
29UniProtVAR_065648T230PSTK11_HUMANUnclassified  ---FT230P
30UniProtVAR_065649F231LSTK11_HUMANUnclassified  ---FF231L
31UniProtVAR_065650S232PSTK11_HUMANUnclassified  ---FS232P
32UniProtVAR_033142W239CSTK11_HUMANDisease (PJS)137853082FW239C
33UniProtVAR_065651L245RSTK11_HUMANUnclassified  ---FL245R
34UniProtVAR_065652T250PSTK11_HUMANUnclassified  ---FT250P
38UniProtVAR_065656L285QSTK11_HUMANUnclassified  ---FL285Q
39UniProtVAR_007922R297KSTK11_HUMANDisease (PJS)  ---FR297K
40UniProtVAR_071059W308CSTK11_HUMANDisease (PJS)  ---FW308C
41UniProtVAR_065657P314HSTK11_HUMANUnclassified  ---FP314H
42UniProtVAR_033144P315SSTK11_HUMANDisease (PJS)786202431FP315S
43UniProtVAR_065658P324LSTK11_HUMANUnclassified367807476FP324L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (42, 42)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_033138Y49DSTK11_HUMANUnclassified137853080CY49D
03UniProtVAR_041379P64SSTRAA_HUMANPolymorphism55695051BP64S
04UniProtVAR_065629V66MSTK11_HUMANUnclassified  ---CV66M
05UniProtVAR_006202L67PSTK11_HUMANDisease (PJS)137853077CL67P
06UniProtVAR_065630R86GSTK11_HUMANUnclassified  ---CR86G
07UniProtVAR_041139R87KSTK11_HUMANUnclassified  ---CR87K
08UniProtVAR_033139G135RSTK11_HUMANUnclassified137853081CG135R
09UniProtVAR_065632F157SSTK11_HUMANUnclassified  ---CF157S
10UniProtVAR_065633L160PSTK11_HUMANUnclassified  ---CL160P
11UniProtVAR_033140G163DSTK11_HUMANDisease (TGCT)137853078CG163D
12UniProtVAR_065634Q170PSTK11_HUMANUnclassified  ---CQ170P
13UniProtVAR_065635G171SSTK11_HUMANUnclassified  ---CG171S
14UniProtVAR_065636H174RSTK11_HUMANUnclassified  ---CH174R
15UniProtVAR_071058D176NSTK11_HUMANDisease (PJS)730881979CD176N
16UniProtVAR_065637D176YSTK11_HUMANUnclassified  ---CD176Y
17UniProtVAR_065638I177NSTK11_HUMANUnclassified  ---CI177N
18UniProtVAR_065639N181ESTK11_HUMANUnclassified  ---CN181E
19UniProtVAR_007921D194NSTK11_HUMANDisease (PJS)121913315CA194N
20UniProtVAR_065640D194VSTK11_HUMANUnclassified121913316CA194V
21UniProtVAR_033141D194YSTK11_HUMANUnclassified121913315CA194Y
22UniProtVAR_065641E199KSTK11_HUMANUnclassified121913317CE199K
23UniProtVAR_065642E199QSTK11_HUMANUnclassified  ---CE199Q
24UniProtVAR_065643A205TSTK11_HUMANUnclassified730881981CA205T
25UniProtVAR_065644D208NSTK11_HUMANUnclassified  ---CD208N
26UniProtVAR_065645G215DSTK11_HUMANUnclassified  ---CG215D
27UniProtVAR_065646S216FSTK11_HUMANUnclassified  ---CS216F
28UniProtVAR_065647E223VSTK11_HUMANUnclassified  ---CE223V
29UniProtVAR_065648T230PSTK11_HUMANUnclassified  ---CT230P
30UniProtVAR_065649F231LSTK11_HUMANUnclassified  ---CF231L
31UniProtVAR_065650S232PSTK11_HUMANUnclassified  ---CS232P
32UniProtVAR_033142W239CSTK11_HUMANDisease (PJS)137853082CW239C
33UniProtVAR_065651L245RSTK11_HUMANUnclassified  ---CL245R
34UniProtVAR_065652T250PSTK11_HUMANUnclassified  ---CT250P
35UniProtVAR_065653Y272HSTK11_HUMANUnclassified  ---CY272H
36UniProtVAR_065654D277YSTK11_HUMANUnclassified  ---CD277Y
37UniProtVAR_065655P281LSTK11_HUMANUnclassified121913322CP281L
38UniProtVAR_065656L285QSTK11_HUMANUnclassified  ---CL285Q
39UniProtVAR_007922R297KSTK11_HUMANDisease (PJS)  ---CR297K
40UniProtVAR_071059W308CSTK11_HUMANDisease (PJS)  ---CW308C
41UniProtVAR_065657P314HSTK11_HUMANUnclassified  ---CP314H
42UniProtVAR_033144P315SSTK11_HUMANDisease (PJS)786202431CP315S
43UniProtVAR_065658P324LSTK11_HUMANUnclassified367807476CP324L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.STK11_HUMAN55-78
 
  2C:55-78
F:55-78
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.STK11_HUMAN172-184
 
  2C:172-184
F:172-184
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.STK11_HUMAN55-78
 
  1-
F:55-78
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.STK11_HUMAN172-184
 
  1-
F:172-184
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.STK11_HUMAN55-78
 
  1C:55-78
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.STK11_HUMAN172-184
 
  1C:172-184
-

(-) Exons   (8, 16)

Asymmetric Unit (8, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002584181ENSE00001154635chr2:231577560-231577945386CAB39_HUMAN-00--
1.3ENST000002584183ENSE00001174710chr2:231624674-231624830157CAB39_HUMAN1-38382A:9-38 (gaps)
D:10-38
30
29
1.5bENST000002584185bENSE00000922487chr2:231655587-231655751165CAB39_HUMAN39-93552A:39-93 (gaps)
D:39-93 (gaps)
55
55
1.6ENST000002584186ENSE00000965551chr2:231657928-231658046119CAB39_HUMAN94-133402A:94-133
D:94-133
40
40
1.7aENST000002584187aENSE00000965552chr2:231663444-231663612169CAB39_HUMAN133-189572A:133-189
D:133-189
57
57
1.8ENST000002584188ENSE00000922489chr2:231674978-23167503760CAB39_HUMAN190-209202A:190-209
D:190-209
20
20
1.9bENST000002584189bENSE00000922490chr2:231678764-23167882966CAB39_HUMAN210-231222A:210-231
D:210-231
22
22
1.10aENST0000025841810aENSE00001722339chr2:231682469-231682612144CAB39_HUMAN232-279482A:232-279
D:232-279
48
48
1.11cENST0000025841811cENSE00001174706chr2:231683231-2316857902560CAB39_HUMAN280-341622A:280-336 (gaps)
D:280-336 (gaps)
57
57

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:321
 aligned with CAB39_HUMAN | Q9Y376 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:328
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328        
          CAB39_HUMAN     9 HKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP 336
               SCOP domains d2wtka_ A: automated  matches                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhh..-..hhhhhhhhhhhhhhhhhhhhhhh--.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh......----hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:9-38 (gaps)  Exon 1.5b  PDB: A:39-93 (gaps) UniProt: 39-93          Exon 1.6  PDB: A:94-133 UniProt: 94-133 --------------------------------------------------------Exon 1.8            Exon 1.9b             Exon 1.10a  PDB: A:232-279 UniProt: 232-279     Exon 1.11c  PDB: A:280-336 (gaps) UniProt: 280-341        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------Exon 1.7a  PDB: A:133-189 UniProt: 133-189               --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2wtk A   9 HKSPADIVKNLKESMAVLEKQ-ISDKKAEKATEEVSKNLVAMKEILY--NEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDR----QFNDEKTYLVKQIRDLKRP 336
                                    18        28| |     38        48      | 58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308    |  318       328        
                                               29 |                      55 58                                                                                                                                                                                                                                                            313  318                  
                                                 31                                                                                                                                                                                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:311
 aligned with STRAA_HUMAN | Q7RTN6 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:371
                                    70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430 
          STRAA_HUMAN    61 SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF 431
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeeeeeee....eeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.........eeee...eeeeeee....eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee.hhhhhee.ee..ee..........hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh....-..hhhhhhhh..---....------------------------------------------------.hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh....hhhhhhhhh...........hhhhhh.........--------.... Sec.struct. author
                 SAPs(SNPs) ---S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wtk B  61 SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPF-DMPATQMLLEKL---VPCL------------------------------------------------FSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVT--------DWEF 431
                                    70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270        |-|      290 |   |  |-         -         -         -         -       350       360       370       380       390       400       410        |-       430 
                                                                                                                                                                                                                                                    279 |        292 296  |                                              348                                                                    419      428   
                                                                                                                                                                                                                                                      281               299                                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:285
 aligned with STK11_HUMAN | Q15831 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:296
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336      
          STK11_HUMAN    47 GKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLE 342
               SCOP domains d2wtkc1 C:47-310 automated matches                                                                                                                                                                                                                                      ----- ---------    ---   ------- SCOP domains
               CATH domains 2wtkC01 C:47-131,C:336-342 Phosphorylase Kinase; domain 1                            ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------    ---   2wtkC01 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee....eeeeee......eeeeeeehhhhhhhh.hhhhhhhhhhhhhh.........eeeeee..---.eeeeee...eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee........ee.....hhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh........hhhhhhhhhhhhh....-.........----...---..hhhhh Sec.struct. author
             SAPs(SNPs) (1) --D----------------MP------------------GK-----------------------------------------------R---------------------S--P--D------PS--R-NN---E------------N----K-----T--N------DF------V------PLP------C-----R----P---------------------H----Y---L---Q-----------K----------C-----HS--------L------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------Y-----------------V----Q----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------------------------------------------------------------------------------------------------------------Y---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE --------PROTEIN_KINASE_ATP      ---------------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wtk C  47 GKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE---KMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISALGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPP-EAPVPIPPS----DRW---TVVPYLE 342
                                    56        66        76        86        96       106       116   |   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306        |-|       |-   | | 336      
                                                                                                   120 124                                                                                                                                                                                            315 |     325  330 | 336      
                                                                                                                                                                                                                                                                                                        317            332          

Chain D from PDB  Type:PROTEIN  Length:325
 aligned with CAB39_HUMAN | Q9Y376 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:327
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       
          CAB39_HUMAN    10 KSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP 336
               SCOP domains d2wtkd_ D: automated matches                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Mo25-2wtkD01 D:10-335                                                                                                                                                                                                                                                                                                                 - Pfam domains (1)
           Pfam domains (2) Mo25-2wtkD02 D:10-335                                                                                                                                                                                                                                                                                                                 - Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..-...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh....-..hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: D:10-38       Exon 1.5b  PDB: D:39-93 (gaps) UniProt: 39-93          Exon 1.6  PDB: D:94-133 UniProt: 94-133 --------------------------------------------------------Exon 1.8            Exon 1.9b             Exon 1.10a  PDB: D:232-279 UniProt: 232-279     Exon 1.11c  PDB: D:280-336 (gaps) UniProt: 280-341        Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------Exon 1.7a  PDB: D:133-189 UniProt: 133-189               --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2wtk D  10 KSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTN-KEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDR-EDEQFNDEKTYLVKQIRDLKRP 336
                                    19        29        39        49        |-|       69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309   | | 319       329       
                                                                           58 |                                                                                                                                                                                                                                                          313 |                     
                                                                             60                                                                                                                                                                                                                                                            315                     

Chain E from PDB  Type:PROTEIN  Length:308
 aligned with STRAA_HUMAN | Q7RTN6 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:372
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429  
          STRAA_HUMAN    60 SSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF 431
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -----   -Pkinase-2wtkE01 E:69-379                                                                                                                                                                                                                                                                                               ---------------------------------------         ---- Pfam domains (1)
           Pfam domains (2) -----   -Pkinase-2wtkE02 E:69-379                                                                                                                                                                                                                                                                                               ---------------------------------------         ---- Pfam domains (2)
         Sec.struct. author .....---..eeeeeeeeehhh.eeeeeeee....eeeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee.hhhhhee.ee..ee.............hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh....-..hhhhhhhhhh--....-------------------------------------------------.hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhhh......hhhhhh..........hhhhh.........---------.... Sec.struct. author
                 SAPs(SNPs) I---S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2wtk E  60 SSFLP---CYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPF-DMPATQMLLEKL--TVPC-------------------------------------------------FSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLV---------DWEF 431
                                |   69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279 |     289  |  |  |-         -         -         -         -       349       359       369       379       389       399       409        |-       429  
                               64  68                                                                                                                                                                                                                279 |        292  |  |                                               348                                                                   418       428   
                                                                                                                                                                                                                                                       281           295  |                                                                                                                                     
                                                                                                                                                                                                                                                                        298                                                                                                                                     

Chain F from PDB  Type:PROTEIN  Length:268
 aligned with STK11_HUMAN | Q15831 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:296
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334      
          STK11_HUMAN    45 LIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPY 340
               SCOP domains d2wtkf1 F:45-310 automated matches                                                                                                                                                                                                                                        ----- --------           ----- SCOP domains
               CATH domains 2wtkF01 F:45-131,F:336-340 Phosphorylase Kinase; domain 1                              ------------------------------------------------------------------------------------------------------------------------------    ---------  ----     ---------------------------------- --------           2wtkF CATH domains
           Pfam domains (1) ----Pkinase-2wtkF01 F:49-309                                                                                                                                                                                                                                             ------ --------           ----- Pfam domains (1)
           Pfam domains (2) ----Pkinase-2wtkF02 F:49-309                                                                                                                                                                                                                                             ------ --------           ----- Pfam domains (2)
         Sec.struct. author ....eeeeeeeee....eeeeeee.....eeeeee.hhhhhhh..hhhhhhhhhhhhhhh........eeeee..-----.eeeee...eehhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee........ee.....hhhhh..........eehhhhhhhhhhhhhhhhhhh......----hhhhhhh..--....-----hhhhhhhhh........hhhhhhhhhhhhh....-........-----------..... Sec.struct. author
             SAPs(SNPs) (1) ----D----------------MP------------------GK-----------------------------------------------R---------------------S--P--D------PS--R-NN---E------------N----K-----T--N------DF------V------PLP------C-----R----P----------------------------------Q-----------K----------C-----HS--------L---------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------Y-----------------V----Q--------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ----------PROTEIN_KINASE_ATP      ---------------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wtk F  45 LIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYN-----MYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISALGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEG----KLFENIGKG--AIPG-----LSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPP-EAPVPIPP-----------TVVPY 340
                                    54        64        74        84        94       104       114    |    -|      134       144       154       164       174       184       194       204       214       224       234       244       254  |    264     | 274 |     284       294       304       314| |    324         - |    
                                                                                                    119   125                                                                                                                                 257  262     270  |  |   282                              315 |    324         336    
                                                                                                                                                                                                                                                              273  |                                      317                       
                                                                                                                                                                                                                                                                 276                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 6)

Asymmetric Unit
(-)
Clan: PKinase (934)
(-)
Clan: TPR (230)

(-) Gene Ontology  (78, 104)

Asymmetric Unit(hide GO term definitions)
Chain A,D   (CAB39_HUMAN | Q9Y376)
molecular function
    GO:0019900    kinase binding    Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030295    protein kinase activator activity    Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.
    GO:0043539    protein serine/threonine kinase activator activity    Binds to and increases the activity of a protein serine/threonine kinase.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
    GO:0032147    activation of protein kinase activity    Any process that initiates the activity of an inactive protein kinase.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0071476    cellular hypotonic response    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of detection of, or exposure to, a hypotonic environment, i.e. an environment with a lower concentration of solutes than the organism or cell.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:1901380    negative regulation of potassium ion transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
    GO:1901017    negative regulation of potassium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transporter activity.
    GO:2000687    negative regulation of rubidium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of rubidium ion transmembrane transporter activity.
    GO:2000681    negative regulation of rubidium ion transport    Any process that stops, prevents or reduces the frequency, rate or extent of rubidium ion transport.
    GO:0018105    peptidyl-serine phosphorylation    The phosphorylation of peptidyl-serine to form peptidyl-O-phospho-L-serine.
    GO:0010800    positive regulation of peptidyl-threonine phosphorylation    Any process that increases the frequency, rate or extent of peptidyl-threonine phosphorylation. Peptidyl-threonine phosphorylation is the phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0051291    protein heterooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:1902554    serine/threonine protein kinase complex    A protein complex which is capable of protein serine/threonine kinase activity.

Chain B,E   (STRAA_HUMAN | Q7RTN6)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0019900    kinase binding    Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030295    protein kinase activator activity    Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0043539    protein serine/threonine kinase activator activity    Binds to and increases the activity of a protein serine/threonine kinase.
biological process
    GO:0032147    activation of protein kinase activity    Any process that initiates the activity of an inactive protein kinase.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0006611    protein export from nucleus    The directed movement of a protein from the nucleus into the cytoplasm.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,F   (STK11_HUMAN | Q15831)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0030275    LRR domain binding    Interacting selectively and non-covalently with a LRR domain (leucine rich repeats) of a protein.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0002039    p53 binding    Interacting selectively and non-covalently with one of the p53 family of proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030295    protein kinase activator activity    Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0051645    Golgi localization    Any process in which the Golgi is transported to, and/or maintained in, a specific location within the cell.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0036399    TCR signalosome assembly    The aggregation, arrangement and bonding together of a set of components to form a TCR signalosome.
    GO:0032147    activation of protein kinase activity    Any process that initiates the activity of an inactive protein kinase.
    GO:0043276    anoikis    Apoptosis triggered by inadequate or inappropriate adherence to substrate e.g. after disruption of the interactions between normal epithelial cells and the extracellular matrix.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0007409    axonogenesis    De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon.
    GO:0060070    canonical Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes. In this pathway, the activated receptor signals via downstream effectors that result in the inhibition of beta-catenin phosphorylation, thereby preventing degradation of beta-catenin. Stabilized beta-catenin can then accumulate and travel to the nucleus to trigger changes in transcription of target genes.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0071493    cellular response to UV-B    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
    GO:0097484    dendrite extension    Long distance growth of a single dendrite involved in cellular development.
    GO:0030010    establishment of cell polarity    The specification and formation of anisotropic intracellular organization or cell growth patterns.
    GO:0042593    glucose homeostasis    Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
    GO:0072332    intrinsic apoptotic signaling pathway by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
    GO:1904262    negative regulation of TORC1 signaling    Any process that stops, prevents or reduces the frequency, rate or extent of TORC1 signaling.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0060770    negative regulation of epithelial cell proliferation involved in prostate gland development    Any process that decreases the rate, frequency or extent of epithelial cell proliferation that contributes to the progression of the prostate gland over time.
    GO:0051055    negative regulation of lipid biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of lipids.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0010508    positive regulation of autophagy    Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
    GO:0050772    positive regulation of axonogenesis    Any process that activates or increases the frequency, rate or extent of axonogenesis.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:1900182    positive regulation of protein localization to nucleus    Any process that activates or increases the frequency, rate or extent of protein localization to nucleus.
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0030511    positive regulation of transforming growth factor beta receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of TGF-beta receptor signaling pathway activity.
    GO:0045059    positive thymic T cell selection    The process of sparing immature T cells in the thymus which react with self-MHC protein complexes with low affinity levels from apoptotic death.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0030111    regulation of Wnt signaling pathway    Any process that modulates the frequency, rate or extent of the activity of the Wnt signal transduction pathway.
    GO:0001558    regulation of cell growth    Any process that modulates the frequency, rate, extent or direction of cell growth.
    GO:0048814    regulation of dendrite morphogenesis    Any process that modulates the frequency, rate or extent of dendrite morphogenesis.
    GO:0051896    regulation of protein kinase B signaling    Any process that modulates the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0010212    response to ionizing radiation    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
    GO:0007286    spermatid development    The process whose specific outcome is the progression of a spermatid over time, from its formation to the mature structure.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
    GO:0001894    tissue homeostasis    A homeostatic process involved in the maintenance of an internal steady state within a defined tissue of an organism, including control of cellular proliferation and death and control of metabolic function.
    GO:0001944    vasculature development    The process whose specific outcome is the progression of the vasculature over time, from its formation to the mature structure. The vasculature is an interconnected tubular multi-tissue structure that contains fluid that is actively transported around the organism.
cellular component
    GO:0036398    TCR signalosome    A multi-protein complex containing at least the T-cell receptor complex and the LAT (linker for activation of T cells) scaffold protein. Also contains a variety of signaling proteins including co-receptors, kinases, phosphatases and adaptors such as CD8. Connects events on the plasma membrane to distal signaling cascades to ultimately modulate T cell biology.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ANP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wtk)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wtk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAB39_HUMAN | Q9Y376
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  STK11_HUMAN | Q15831
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  STRAA_HUMAN | Q7RTN6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  175200
    Disease InformationOMIM
  273300
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAB39_HUMAN | Q9Y376
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  STK11_HUMAN | Q15831
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  STRAA_HUMAN | Q7RTN6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAB39_HUMAN | Q9Y3761upk 1upl 3gni 4fza 4fzd 4fzf 4nzw 4o27
        STK11_HUMAN | Q158314zdr 5wxn
        STRAA_HUMAN | Q7RTN61upk 3gni

(-) Related Entries Specified in the PDB File

1upk CRYSTAL STRUCTURE OF MO25 IN COMPLEX WITH A C-TERMINAL PEPTIDE OF STRAD
1upl CRYSTAL STRUCTURE OF MO25 ALPHA