2WEF - JenaLib

Title :   HUMAN 3'(2'), 5'-BISPHOSPHATE NUCLEOTIDASE 1 (BPNT1) IN COMPLEX WITH AMP, PO4 AND MAGNESIUM

Authors :   M. Moche, P. Schutz, C. H. Arrowsmith, H. Berglund, C. Bountra, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, A. Johansson, I. Johansson, T. Karlberg, T. Kotenyova, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, H. Schueler, M. I. Siponen, A. G. Thorsell, L. Tresaugues, S. Van Der Berg, J. Weigelt, M. Welin, M. Wisniewska, P. Nordlund, Structural Genomics Consortium (Sgc)

Date :   30 Mar 09 (Deposition) - 14 Apr 09 (Release) - 29 Apr 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Hydrolase, Sulfur Metabolism, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Moche, P. Schutz, C. H. Arrowsmith, H. Berglund, C. Bountra, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, A. Johansson, I. Johansson, T. Karlberg, T. Kotenyova, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, H. Schueler, M. I. Siponen, A. G. Thorsell, L. Tresaugues, S. Van Den Berg, J. Weigelt, M. Welin, M. Wisniewska, P. Nordlund
Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 ( Bpnt1) In Complex With Amp, Po4 And Magnesium
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 5)

Sites (5, 5)

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:117 , ASP A:120 , ASP A:247 , MG A:402 , PO4 A:501 , AMP A:601 , HOH A:2206	BINDING SITE FOR RESIDUE MG A 401
2	AC2	SOFTWARE	GLU A:74 , ASP A:117 , LEU A:119 , MG A:401 , PO4 A:501 , HOH A:2038	BINDING SITE FOR RESIDUE MG A 402
3	AC3	SOFTWARE	GLU A:74 , PO4 A:501 , HOH A:2033 , HOH A:2035 , HOH A:2064 , HOH A:2249	BINDING SITE FOR RESIDUE MG A 403
4	AC4	SOFTWARE	ASP A:51 , GLU A:74 , ASP A:117 , LEU A:119 , ASP A:120 , GLY A:121 , THR A:122 , MG A:401 , MG A:402 , MG A:403 , AMP A:601 , HOH A:2035 , HOH A:2038 , HOH A:2064 , HOH A:2206 , HOH A:2248 , HOH A:2249	BINDING SITE FOR RESIDUE PO4 A 501
5	AC5	SOFTWARE	ASP A:120 , THR A:195 , HIS A:198 , GLY A:220 , LYS A:224 , PHE A:238 , GLY A:242 , CYS A:243 , ASP A:247 , MG A:401 , PO4 A:501 , HOH A:2118 , HOH A:2206 , HOH A:2249 , HOH A:2250 , HOH A:2251	BINDING SITE FOR RESIDUE AMP A 601

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:303
 aligned with BPNT1_HUMAN | O95861 from UniProtKB/Swiss-Prot  Length:308

    Alignment length:303
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305   
          BPNT1_HUMAN     6 TVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP 308
               SCOP domains d2wefa_ A: automated matches                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2wefA01 A:6-179 Fructose-1,6-Bisphosphatase, subunit A, domain 1                                                                                                              2wefA02 A:180-308  [code=3.40.190.80, no name defined]                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..eeehhhhhhhhhhhhhhhhhhh...eeee.........hhhhh....hhhhhh...hhhhh..hhh.eeeeeeeeehhhhhhh.hhhhheeeeeeee..eeeeeeeee..............eeeeee...eee............eeee.....hhhhhhhhhh....eeee..hhhhhhhhhhh....eeee.....hhhhhhhhhhhhhhh..eee....................eeee..hhhhhhh..hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------IMP_1        -----------------------------------------------------------------------------------------------------------------------IMP_2          ------------------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wef A   6 TVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP 308
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (BPNT1_HUMAN | O95861)

molecular function
	GO:0008441	3'(2'),5'-bisphosphate nucleotidase activity	Catalysis of the reaction: adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004441	inositol-1,4-bisphosphate 1-phosphatase activity	Catalysis of the reaction: 1D-myo-inositol 1,4-bisphosphate + H2O = 1D-myo-inositol 4-phosphate + phosphate.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wef)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2wef
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BPNT1_HUMAN \| O95861
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description