Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE C-TERMINAL REGION OF HUMAN IASPP
 
Authors :  R. A. Robinson, X. Lu, E. Y. Jones, C. Siebold
Date :  12 Nov 07  (Deposition) - 05 Feb 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Iaspp, Nucleus, Apoptosis, Repressor, Cytoplasm, Phosphorylation, P53 Binding Protein, Ank Repeat, Sh3 Domain, Transcription, Ankyrin Repeats, Alternative Splicing, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. A. Robinson, X. Lu, E. Y. Jones, C. Siebold
Biochemical And Structural Studies Of Aspp Proteins Reveal Differential Binding To P53, P63 And P73
Structure V. 16 259 2008
PubMed-ID: 18275817  |  Reference-DOI: 10.1016/J.STR.2007.11.012

(-) Compounds

Molecule 1 - RELA-ASSOCIATED INHIBITOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET 22B
    Expression System StrainROSETTA (DE3) PLYSS
    Expression System Taxid562
    FragmentP53 (CORE) BINDING DOMAIN, RESIDUES 607-828
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymINHIBITOR OF ASPP PROTEIN, PROTEIN IASPP, PPP1R13B-LIKE PROTEIN, NFKB-INTERACTING PROTEIN 1, IASPP

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2VGE)

(-) Sites  (0, 0)

(no "Site" information available for 2VGE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2VGE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2VGE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2VGE)

(-) PROSITE Motifs  (3, 4)

Asymmetric/Biological Unit (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANK_REP_REGIONPS50297 Ankyrin repeat region circular profile.IASPP_HUMAN626-731  1A:626-731
2ANK_REPEATPS50088 Ankyrin repeat profile.IASPP_HUMAN659-691
692-724
  2A:659-691
A:692-724
3SH3PS50002 Src homology 3 (SH3) domain profile.IASPP_HUMAN758-820  1A:758-820

(-) Exons   (5, 5)

Asymmetric/Biological Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000003609572ENSE00001510129chr19:45908312-4590825756IASPP_HUMAN-00--
1.3ENST000003609573ENSE00001428906chr19:45901597-4590152276IASPP_HUMAN1-19190--
1.4ENST000003609574ENSE00001429983chr19:45901405-45901263143IASPP_HUMAN19-66480--
1.5ENST000003609575ENSE00001407125chr19:45900316-45899803514IASPP_HUMAN67-2381720--
1.6ENST000003609576ENSE00001403786chr19:45899694-4589959699IASPP_HUMAN238-271340--
1.7ENST000003609577ENSE00001432736chr19:45899517-4589942692IASPP_HUMAN271-301310--
1.8aENST000003609578aENSE00001426671chr19:45899144-45898694451IASPP_HUMAN302-4521510--
1.10bENST0000036095710bENSE00001399713chr19:45895598-45895138461IASPP_HUMAN452-6051540--
1.11ENST0000036095711ENSE00000861586chr19:45889438-45889307132IASPP_HUMAN606-649441A:616-64934
1.12ENST0000036095712ENSE00000712870chr19:45889215-45889082134IASPP_HUMAN650-694451A:650-69445
1.13ENST0000036095713ENSE00000712874chr19:45888986-45888820167IASPP_HUMAN694-750571A:694-75057
1.14ENST0000036095714ENSE00000861587chr19:45885984-45885785200IASPP_HUMAN750-816671A:750-81667
1.15ENST0000036095715ENSE00001423606chr19:45883486-45882892595IASPP_HUMAN817-828121A:817-8237

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:208
 aligned with IASPP_HUMAN | Q8WUF5 from UniProtKB/Swiss-Prot  Length:828

    Alignment length:208
                                   625       635       645       655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805       815        
          IASPP_HUMAN   616 SPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKP 823
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhh...............hhhhh.....hhhhhhhhhhhhhhhh..hhh.eeee..................eeeeee........eeeeee..eeeeee...ee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------ANK_REP_REGION  PDB: A:626-731 UniProt: 626-731                                                           --------------------------SH3  PDB: A:758-820 UniProt: 758-820                           --- PROSITE (1)
                PROSITE (2) -------------------------------------------ANK_REPEAT  PDB: A:659-691       ANK_REPEAT  PDB: A:692-724       --------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.11  PDB: A:616-649         Exon 1.12  PDB: A:650-694 UniProt: 650-694   -------------------------------------------------------Exon 1.14  PDB: A:750-816 UniProt: 750-816                         1.15    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------Exon 1.13  PDB: A:694-750 UniProt: 694-750               ------------------------------------------------------------------------- Transcript 1 (2)
                 2vge A 616 SPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKP 823
                                   625       635       645       655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805       815        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2VGE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2VGE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2VGE)

(-) Gene Ontology  (23, 23)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (IASPP_HUMAN | Q8WUF5)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003714    transcription corepressor activity    Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0003215    cardiac right ventricle morphogenesis    The process in which the right cardiac ventricle is generated and organized.
    GO:0031076    embryonic camera-type eye development    The process occurring during the embryonic phase whose specific outcome is the progression of the eye over time, from its formation to the mature structure.
    GO:0042633    hair cycle    The cyclical phases of growth (anagen), regression (catagen), quiescence (telogen), and shedding (exogen) in the life of a hair; one of the collection or mass of filaments growing from the skin of an animal, and forming a covering for a part of the head or for any part or the whole of the body.
    GO:0035264    multicellular organism growth    The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
    GO:0048871    multicellular organismal homeostasis    Any process involved in the maintenance of an internal steady state at the level of the multicellular organism.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045597    positive regulation of cell differentiation    Any process that activates or increases the frequency, rate or extent of cell differentiation.
    GO:0009791    post-embryonic development    The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0003229    ventricular cardiac muscle tissue development    The process whose specific outcome is the progression of ventricular cardiac muscle over time, from its formation to the mature structure.
cellular component
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0045171    intercellular bridge    A direct connection between the cytoplasm of two cells that is formed following the completion of cleavage furrow ingression during cell division. They are usually present only briefly prior to completion of cytokinesis. However, in some cases, such as the bridges between germ cells during their development, they become stabilised.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2vge)
 
  Sites
(no "Sites" information available for 2vge)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2vge)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2vge
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IASPP_HUMAN | Q8WUF5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IASPP_HUMAN | Q8WUF5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2VGE)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2VGE)