Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHD FINGER-LINKER-BROMODOMAIN Y17E MUTANT FROM HUMAN BPTF IN THE H3(1-9)K4ME2 BOUND STATE
 
Authors :  H. Li, D. J. Patel
Date :  10 Oct 07  (Deposition) - 11 Dec 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A,P
Keywords :  Zinc Finger, Alpha-Helical Bundle, Dimethyl-Lysine, Bromodomain, Chromatin Regulator, Metal-Binding, Nucleus, Phosphorylation, Transcription, Transcription Regulation, Zinc-Finger, Transcription- Nuclear Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Li, W. Fischle, W. Wang, E. M. Duncan, L. Liang, S. Murakami-Ishibe, C. D. Allis, D. J. Patel
Structural Basis For Lower Lysine Methylation State-Specifi Readout By Mbt Repeats Of L3Mbtl1 And An Engineered Phd Finger.
Mol. Cell V. 28 677 2007
PubMed-ID: 18042461  |  Reference-DOI: 10.1016/J.MOLCEL.2007.10.023

(-) Compounds

Molecule 1 - NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX6P
    Expression System StrainROSETTA2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentPHD-TYPE 2 DOMAIN AND BROMO DOMAIN;
RESIDUES 2726-2894
    GeneBPTF, FAC1, FALZ
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBROMODOMAIN AND PHD FINGER- CONTAINING TRANSCRIPTION FACTOR, FETAL ALZHEIMER ANTIGEN, FETAL ALZ- 50 CLONE 1 PROTEIN
 
Molecule 2 - HISTONE H3.1
    ChainsP
    EngineeredYES
    FragmentN-TERMINAL TAIL RESIDUES 2-10
    Other DetailsTHIS SEQUENCE OCCURS NATURALLY IN HUMANS
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric/Biological Unit (4, 5)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2IPA1Ligand/IonISOPROPYL ALCOHOL
3MLY1Mod. Amino AcidN-DIMETHYL-LYSINE
4ZN2Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:11 , CYS A:13 , HIS A:34 , CYS A:37BINDING SITE FOR RESIDUE ZN A 501
2AC2SOFTWARECYS A:26 , CYS A:29 , CYS A:53 , CYS A:56BINDING SITE FOR RESIDUE ZN A 502
3AC3SOFTWARECYS A:29 , GLN A:55 , CYS A:56 , VAL A:160 , HOH A:789BINDING SITE FOR RESIDUE GOL A 503
4AC4SOFTWAREPRO A:92 , CYS A:144 , ASN A:148 , HOH A:812BINDING SITE FOR RESIDUE IPA A 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RI7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RI7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RI7)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.BPTF_HUMAN390-437
2867-2918
  1-
A:8-59
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.BPTF_HUMAN393-434
2870-2915
  1-
A:11-56
3BROMODOMAIN_2PS50014 Bromodomain profile.BPTF_HUMAN2944-3014  1A:85-155
4BROMODOMAIN_1PS00633 Bromodomain signature.BPTF_HUMAN2949-3006  1A:90-147

(-) Exons   (5, 5)

Asymmetric/Biological Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003218921cENSE00001357454chr17:65821780-65822453674BPTF_HUMAN1-2052050--
1.2ENST000003218922ENSE00001148014chr17:65850056-65850878823BPTF_HUMAN205-4792750--
1.3ENST000003218923ENSE00001148007chr17:65862580-65862803224BPTF_HUMAN479-554760--
1.4ENST000003218924ENSE00001147999chr17:65870933-65871136204BPTF_HUMAN554-622690--
1.5ENST000003218925ENSE00001147993chr17:65871672-65871860189BPTF_HUMAN622-685640--
1.7ENST000003218927ENSE00001147984chr17:65882244-65882432189BPTF_HUMAN685-748640--
1.8ENST000003218928ENSE00001147980chr17:65887960-65888150191BPTF_HUMAN748-811640--
1.9ENST000003218929ENSE00001223583chr17:65889486-65889841356BPTF_HUMAN812-9301190--
1.10ENST0000032189210ENSE00001612408chr17:65890150-65890281132BPTF_HUMAN930-974450--
1.11ENST0000032189211ENSE00002166039chr17:65899905-65900034130BPTF_HUMAN974-1017440--
1.12ENST0000032189212ENSE00001750925chr17:65900818-65900956139BPTF_HUMAN1018-1064470--
1.13ENST0000032189213ENSE00001665602chr17:65905698-65905877180BPTF_HUMAN1064-1124610--
1.14ENST0000032189214ENSE00001606591chr17:65906993-659093032311BPTF_HUMAN1124-18947710--
1.15ENST0000032189215ENSE00001657056chr17:65914830-65914954125BPTF_HUMAN1894-1936430--
1.16ENST0000032189216ENSE00001625445chr17:65916131-65916259129BPTF_HUMAN1936-1979440--
1.17ENST0000032189217ENSE00001642854chr17:65918956-65919106151BPTF_HUMAN1979-2029510--
1.18ENST0000032189218ENSE00001783568chr17:65920663-6592070543BPTF_HUMAN2029-2043150--
1.19ENST0000032189219ENSE00001604847chr17:65924471-65924717247BPTF_HUMAN2044-2126830--
1.20ENST0000032189220ENSE00001680408chr17:65925452-65925603152BPTF_HUMAN2126-2176510--
1.21ENST0000032189221ENSE00001779718chr17:65928027-65928135109BPTF_HUMAN2177-2213370--
1.22ENST0000032189222ENSE00001770472chr17:65936555-65936772218BPTF_HUMAN2213-2285730--
1.23aENST0000032189223aENSE00001733774chr17:65940266-65940488223BPTF_HUMAN2286-2360750--
1.24cENST0000032189224cENSE00001223457chr17:65941525-65942441917BPTF_HUMAN2360-26653060--
1.25ENST0000032189225ENSE00001603899chr17:65943842-6594392483BPTF_HUMAN2666-2693280--
1.26ENST0000032189226ENSE00001707553chr17:65944197-65944422226BPTF_HUMAN2693-2768760--
1.27aENST0000032189227aENSE00001743235chr17:65955657-65955991335BPTF_HUMAN2769-28801121A:7-2115
1.29ENST0000032189229ENSE00001707648chr17:65960328-65960520193BPTF_HUMAN2880-2944651A:21-8565
1.30ENST0000032189230ENSE00001598996chr17:65962688-6596277285BPTF_HUMAN2945-2973291A:86-11429
1.31ENST0000032189231ENSE00001755666chr17:65971888-65972074187BPTF_HUMAN2973-3035631A:114-17461
1.32cENST0000032189232cENSE00001766345chr17:65978368-659804942127BPTF_HUMAN3035-3046120--

2.2bENST000003593032bENSE00001974165chr6:27858570-27858160411H31_HUMAN1-1361361P:1-66

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:168
 aligned with BPTF_HUMAN | Q12830 from UniProtKB/Swiss-Prot  Length:3046

    Alignment length:168
                                  2875      2885      2895      2905      2915      2925      2935      2945      2955      2965      2975      2985      2995      3005      3015      3025        
          BPTF_HUMAN   2866 TKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA 3033
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ---PHD-2ri7A02 A:10-59                               -----------------Bromodomain-2ri7A01 A:77-160                                                        -------------- Pfam domains
         Sec.struct. author ..ee....ee......eee......eeehhhhh.hhhhhh......hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -ZF_PHD_2  PDB: A:8-59 UniProt: 2867-2918            -------------------------BROMODOMAIN_2  PDB: A:85-155 UniProt: 2944-3014                        ------------------- PROSITE (1)
                PROSITE (2) ----ZF_PHD_1  PDB: A:11-56 UniProt: 2870-2915     ---------------------------------BROMODOMAIN_1  PDB: A:90-147 UniProt: 2949-3006           --------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.27a     ----------------------------------------------------------------Exon 1.30  PDB: A:86-114     ------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.29  PDB: A:21-85 UniProt: 2880-2944                       ----------------------------Exon 1.31  PDB: A:114-174 UniProt: 2973-3035 [INCOMPLETE]     Transcript 1 (2)
                2ri7 A    7 TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA  174
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166        

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:6
           H31_HUMAN      2 ARTKQT    7
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ..ee.. Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
               Transcript 2 2.2b   Transcript 2
                2ri7 P    1 ARTkQT    6
                               |  
                               4-MLY

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2RI7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RI7)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (50, 54)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (BPTF_HUMAN | Q12830)
molecular function
    GO:0008094    DNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of single- or double-stranded DNA, and it drives another reaction.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0009952    anterior/posterior pattern specification    The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:1990090    cellular response to nerve growth factor stimulus    A process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nerve growth factor stimulus.
    GO:0006338    chromatin remodeling    Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
    GO:0001892    embryonic placenta development    The embryonically driven process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016589    NURF complex    An ISWI complex that contains an ATPase subunit of the ISWI family (SNF2L in mammals), a NURF301 homolog (BPTF in humans), and additional subunits, though the composition of these additional subunits varies slightly with species. NURF is involved in regulation of transcription from TRNA polymerase II promoters.
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

Chain P   (H31_HUMAN | P68431)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0042393    histone binding    Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
    GO:0006335    DNA replication-dependent nucleosome assembly    The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0000183    chromatin silencing at rDNA    Repression of transcription of ribosomal DNA by altering the structure of chromatin.
    GO:0031047    gene silencing by RNA    Any process in which RNA molecules inactivate expression of target genes.
    GO:0045814    negative regulation of gene expression, epigenetic    Any epigenetic process that stops, prevents or reduces the rate of gene expression.
    GO:0006334    nucleosome assembly    The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0045815    positive regulation of gene expression, epigenetic    Any epigenetic process that activates or increases the rate of gene expression.
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
    GO:0060968    regulation of gene silencing    Any process that modulates the rate, frequency, or extent of gene silencing, the transcriptional or post-transcriptional process carried out at the cellular level that results in long-term gene inactivation.
    GO:0032200    telomere organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of telomeres, terminal regions of a linear chromosome that include the telomeric DNA repeats and associated proteins.
    GO:0098792    xenophagy    The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0000228    nuclear chromosome    A chromosome that encodes the nuclear genome and is found in the nucleus of a eukaryotic cell during the cell cycle phases when the nucleus is intact.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0000788    nuclear nucleosome    A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA in the nucleus into higher order structures.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0000786    nucleosome    A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MLY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ri7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ri7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BPTF_HUMAN | Q12830
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  H31_HUMAN | P68431
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BPTF_HUMAN | Q12830
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  H31_HUMAN | P68431
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BPTF_HUMAN | Q128302f6j 2f6n 2fsa 2fui 2fuu 3qzs 3qzt 3qzv 3uv2
        H31_HUMAN | P684311cs9 1ct6 1guw 1o9s 1q3l 2b2t 2b2u 2b2v 2b2w 2c1j 2c1n 2cv5 2kwj 2kwk 2l75 2lbm 2m0o 2ndf 2ndg 2oq6 2ot7 2ox0 2uxn 2v89 2vpg 2x0l 3a1b 3afa 3avr 3ayw 3aze 3azf 3azg 3azh 3azi 3azj 3azk 3azl 3azm 3azn 3b95 3kmt 3kqi 3lqi 3lqj 3o34 3o35 3o37 3qj6 3rig 3riy 3sou 3sow 3u31 3u3d 3u4s 3u5n 3u5o 3u5p 3uee 3uef 3uig 3uii 3uik 3v43 3w96 3w97 3w98 3w99 3wa9 3waa 3wkj 3x1s 3x1t 3x1u 3x1v 3zg6 3zvy 4a0j 4a0n 4a7j 4bd3 4c1q 4f4u 4f56 4ft2 4ft4 4fwf 4hon 4i51 4l7x 4lk9 4lka 4llb 4lxl 4n4h 4qbq 4qbr 4qbs 4tn7 4u68 4up0 4uy4 4x3k 4y6l 4yhp 4yhz 4ym5 4ym6 4z0r 4z2m 5av5 5av6 5av8 5av9 5avb 5avc 5b24 5b2i 5b2j 5b31 5c11 5c13 5c3i 5cpi 5cpj 5cpk 5d6y 5dah 5fb0 5fb1 5ffv 5gse 5gsu 5gt0 5gt3 5gtc 5hjb 5hjc 5hjd 5hyn 5iql 5j3v 5j9s 5jhn 5jin 5jiy 5jj0 5jrg 5kjh 5kji 5kkl 5m5g 5svx 5svy 5t0k 5t0m 5t1g 5t1i 5t8r 5tbn 5tdr 5tdw 5v21 5v22 5va6

(-) Related Entries Specified in the PDB File

2f6j CRYSTAL STRUCTURE OF PHD FINGER-LINKER-BROMODOMAIN FRAGMENT OF HUMAN BPTF IN THE H3(1-15)K4ME3 BOUND STAT
2f6n CRYSTAL STRUCTURE OF PHD FINGER-LINKER-BROMODOMAIN FRAGMENT OF HUMAN BPTF IN THE FREE FORM
2fsa CRYSTAL STRUCTURE OF PHD FINGER-LINKER-BROMODOMAIN FRAGMENT OF HUMAN BPTF IN THE H3(1-15)K4ME2 BOUND STATE