Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL FORM BH2
 
Authors :  S. Bailey, W. K. Eliason, T. A. Steitz
Date :  05 Sep 07  (Deposition) - 10 Jun 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I
Biol. Unit 1:  A,B,C,D,E,F,G,H,I  (2x)
Keywords :  Helicase, Primase, Replication, Dnab, Dnag (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Bailey, W. K. Eliason, T. A. Steitz
Structure Of Hexameric Dnab Helicase And Its Complex With A Domain Of Dnag Primase
Science V. 318 459 2007
PubMed-ID: 17947583  |  Reference-DOI: 10.1126/SCIENCE.1147353

(-) Compounds

Molecule 1 - REPLICATIVE HELICASE
    Chains: A, B, C, D, E, F
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)
    Expression System Vector Type: PLASMID
    Gene: DNAB
    Organism Scientific: BACILLUS STEAROTHERMOPHILUS
    Synonym: DNAB HELICASE
 
Molecule 2 - DNAG PRIMASE, HELICASE BINDING DOMAIN
    Chains: G, H, I
    EC Number: 2.7.7.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)
    Expression System Vector Type: PLASMID
    Fragment: HELICASE BINDING DOMAIN
    Gene: DNAG
    Organism Scientific: BACILLUS STEAROTHERMOPHILUS

 Structural Features

(-) Chains, Units

  123456789
Asymmetric Unit : ABCDEFGHI
Biological Unit 1 (2x): ABCDEFGHI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric Unit (1, 18)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 36)
No.NameCountTypeFull Name
1MSE36Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2R6C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2R6C)

(-) Cis Peptide Bonds  (62, 62)

Asymmetric Unit
No.Residues
1Asp A:27 -Pro A:28
2Arg A:61 -Gly A:62
3Gly A:62 -Glu A:63
4Glu A:63 -Pro A:64
5Tyr A:104 -Tyr A:105
6Glu A:133 -Asp A:134
7Thr A:184 -Gly A:185
8Gly A:199 -Phe A:200
9Gln A:261 -Asn A:262
10Asp B:27 -Pro B:28
11Arg B:61 -Gly B:62
12Gly B:62 -Glu B:63
13Glu B:63 -Pro B:64
14Glu B:103 -Tyr B:104
15Tyr B:104 -Tyr B:105
16Glu B:133 -Asp B:134
17Thr B:184 -Gly B:185
18Gly B:199 -Phe B:200
19Gln B:261 -Asn B:262
20Asp C:27 -Pro C:28
21Arg C:61 -Gly C:62
22Gly C:62 -Glu C:63
23Glu C:63 -Pro C:64
24Tyr C:104 -Tyr C:105
25Glu C:133 -Asp C:134
26Thr C:184 -Gly C:185
27Gly C:199 -Phe C:200
28Gln C:261 -Asn C:262
29Asp D:27 -Pro D:28
30Arg D:61 -Gly D:62
31Gly D:62 -Glu D:63
32Glu D:63 -Pro D:64
33Tyr D:104 -Tyr D:105
34Glu D:133 -Asp D:134
35Thr D:184 -Gly D:185
36Gly D:199 -Phe D:200
37Gln D:261 -Asn D:262
38Asp E:27 -Pro E:28
39Arg E:61 -Gly E:62
40Gly E:62 -Glu E:63
41Glu E:63 -Pro E:64
42Tyr E:104 -Tyr E:105
43Glu E:133 -Asp E:134
44Thr E:184 -Gly E:185
45Gly E:199 -Phe E:200
46Gln E:261 -Asn E:262
47Asp F:27 -Pro F:28
48Arg F:61 -Gly F:62
49Gly F:62 -Glu F:63
50Glu F:63 -Pro F:64
51Tyr F:104 -Tyr F:105
52Glu F:133 -Asp F:134
53Thr F:184 -Gly F:185
54Gly F:199 -Phe F:200
55Gln F:261 -Asn F:262
56Arg F:374 -Pro F:375
57Gly G:486 -Gly G:487
58Gly G:487 -Arg G:488
59Gly H:486 -Gly H:487
60Gly H:487 -Arg H:488
61Gly I:486 -Gly I:487
62Gly I:487 -Arg I:488

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2R6C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2R6C)

(-) Exons   (0, 0)

(no "Exon" information available for 2R6C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhh...............hhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------hhhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c A  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain B from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.hhhhh.hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhh...............hhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------.hhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c B  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain C from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhh...............hhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------.hhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c C  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain D from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhh...............hhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------.hhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c D  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain E from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhh....eeee....hhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------.hhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c E  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain F from PDB  Type:PROTEIN  Length:358
 aligned with Q9X4C9_GEOSE | Q9X4C9 from UniProtKB/TrEMBL  Length:454

    Alignment length:427
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       
         Q9X4C9_GEOSE    15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) DnaB-2r6cF07 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF01 F:185-441                                                                                                                                                                                                                                          Pfam domains (1)
           Pfam domains (2) DnaB-2r6cF08 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF02 F:185-441                                                                                                                                                                                                                                          Pfam domains (2)
           Pfam domains (3) DnaB-2r6cF09 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF03 F:185-441                                                                                                                                                                                                                                          Pfam domains (3)
           Pfam domains (4) DnaB-2r6cF10 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF04 F:185-441                                                                                                                                                                                                                                          Pfam domains (4)
           Pfam domains (5) DnaB-2r6cF11 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF05 F:185-441                                                                                                                                                                                                                                          Pfam domains (5)
           Pfam domains (6) DnaB-2r6cF12 F:15-111                                                                            --------------------------------------                                 --DnaB_C-2r6cF06 F:185-441                                                                                                                                                                                                                                          Pfam domains (6)
         Sec.struct. author hhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.hhhhhh---------------------------------.......hhhhhhhhh......eeeee.....hhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhh...............hhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhh...eeee.hhhhh.-----------hhhhhhhhhhhhhhhhh..eeeee..----------...hhhhhh.........eeee..---------------.eeeeee.....eee..ee......ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r6c F  15 EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESGLGMIVIDYLQLIQ-----------EVSEISRSLKALARELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY---------------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL 441
                                    24        34        44        54        64        74        84        94       104       114       124       134       144    |    -         -         -       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 |       -   |   344       354        |-       374       384       394  |      -       414       424       434       
                                                                                                                                                                149                               183                                                                                                                                            326         338                      363        374                    397             413                            


Chain G from PDB  Type:PROTEIN  Length:138
 aligned with DNAG_GEOSE | Q9X4D0 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:138
                                   465       475       485       495       505       515       525       535       545       555       565       575       585        
           DNAG_GEOSE   456 LLPAFQNAERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASDVSLLLIADDVSEQELEDYIRHVLNRPKWLMLKVKEQEKTEAERRKDFLTAARIAKEMIEMKKM 593
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh......hhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2r6c G 456 LLPAFQNAERLLLAHmmRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASELSLLLIADDVSEQELEDYIRHVLNRPKWLmLKVKEQEKTEAERRKDFLTAARIAKEmIEmKKm 593
                                   465     ||475       485       495       505       515       525       535       545       555    |  565       575       585 |  |  |
                                         471-MSE                                                                                  560-MSE                    587-MSE |
                                          472-MSE                                                                                                               590-MSE
                                                                                                                                                                   593-MSE


Chain H from PDB  Type:PROTEIN  Length:138
 aligned with DNAG_GEOSE | Q9X4D0 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:138
                                   465       475       485       495       505       515       525       535       545       555       565       575       585        
           DNAG_GEOSE   456 LLPAFQNAERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASDVSLLLIADDVSEQELEDYIRHVLNRPKWLMLKVKEQEKTEAERRKDFLTAARIAKEMIEMKKM 593
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh......hhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2r6c H 456 LLPAFQNAERLLLAHmmRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASELSLLLIADDVSEQELEDYIRHVLNRPKWLmLKVKEQEKTEAERRKDFLTAARIAKEmIEmKKm 593
                                   465     ||475       485       495       505       515       525       535       545       555    |  565       575       585 |  |  |
                                         471-MSE                                                                                  560-MSE                    587-MSE |
                                          472-MSE                                                                                                               590-MSE
                                                                                                                                                                   593-MSE


Chain I from PDB  Type:PROTEIN  Length:138
 aligned with DNAG_GEOSE | Q9X4D0 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:138
                                   465       475       485       495       505       515       525       535       545       555       565       575       585        
           DNAG_GEOSE   456 LLPAFQNAERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASDVSLLLIADDVSEQELEDYIRHVLNRPKWLMLKVKEQEKTEAERRKDFLTAARIAKEMIEMKKM 593
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh......hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2r6c I 456 LLPAFQNAERLLLAHmmRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASELSLLLIADDVSEQELEDYIRHVLNRPKWLmLKVKEQEKTEAERRKDFLTAARIAKEmIEmKKm 593
                                   465     ||475       485       495       505       515       525       535       545       555    |  565       575       585 |  |  |
                                         471-MSE                                                                                  560-MSE                    587-MSE |
                                          472-MSE                                                                                                               590-MSE
                                                                                                                                                                   593-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2R6C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2R6C)

(-) Pfam Domains  (2, 12)

Asymmetric Unit
(-)
Clan: P-loop_NTPase (1112)
(-)
Clan: no clan defined [family: DnaB] (9)

(-) Gene Ontology  (19, 27)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (Q9X4C9_GEOSE | Q9X4C9)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003678    DNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0032508    DNA duplex unwinding    The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006269    DNA replication, synthesis of RNA primer    The synthesis of a short RNA polymer, usually 4-15 nucleotides long, using one strand of unwound DNA as a template; the RNA then serves as a primer from which DNA polymerases extend synthesis.
cellular component
    GO:1990077    primosome complex    Any of a family of protein complexes that form at the origin of replication or stalled replication forks and function in replication primer synthesis in all organisms. Early complexes initiate double-stranded DNA unwinding. The core unit consists of a replicative helicase and a primase. The helicase further unwinds the DNA and recruits the polymerase machinery. The primase synthesizes RNA primers that act as templates for complementary stand replication by the polymerase machinery. The primosome contains a number of associated proteins and protein complexes and contributes to the processes of replication initiation, lagging strand elongation, and replication restart.

Chain G,H,I   (DNAG_GEOSE | Q9X4D0)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003678    DNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix.
    GO:0003896    DNA primase activity    Catalysis of the synthesis of a short RNA primer on a DNA template, providing a free 3'-OH that can be extended by DNA-directed DNA polymerases.
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0032508    DNA duplex unwinding    The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006269    DNA replication, synthesis of RNA primer    The synthesis of a short RNA polymer, usually 4-15 nucleotides long, using one strand of unwound DNA as a template; the RNA then serves as a primer from which DNA polymerases extend synthesis.
cellular component
    GO:1990077    primosome complex    Any of a family of protein complexes that form at the origin of replication or stalled replication forks and function in replication primer synthesis in all organisms. Early complexes initiate double-stranded DNA unwinding. The core unit consists of a replicative helicase and a primase. The helicase further unwinds the DNA and recruits the polymerase machinery. The primase synthesizes RNA primers that act as templates for complementary stand replication by the polymerase machinery. The primosome contains a number of associated proteins and protein complexes and contributes to the processes of replication initiation, lagging strand elongation, and replication restart.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2r6c)
 
  Cis Peptide Bonds
    Arg A:61 - Gly A:62   [ RasMol ]  
    Arg B:61 - Gly B:62   [ RasMol ]  
    Arg C:61 - Gly C:62   [ RasMol ]  
    Arg D:61 - Gly D:62   [ RasMol ]  
    Arg E:61 - Gly E:62   [ RasMol ]  
    Arg F:374 - Pro F:375   [ RasMol ]  
    Arg F:61 - Gly F:62   [ RasMol ]  
    Asp A:27 - Pro A:28   [ RasMol ]  
    Asp B:27 - Pro B:28   [ RasMol ]  
    Asp C:27 - Pro C:28   [ RasMol ]  
    Asp D:27 - Pro D:28   [ RasMol ]  
    Asp E:27 - Pro E:28   [ RasMol ]  
    Asp F:27 - Pro F:28   [ RasMol ]  
    Gln A:261 - Asn A:262   [ RasMol ]  
    Gln B:261 - Asn B:262   [ RasMol ]  
    Gln C:261 - Asn C:262   [ RasMol ]  
    Gln D:261 - Asn D:262   [ RasMol ]  
    Gln E:261 - Asn E:262   [ RasMol ]  
    Gln F:261 - Asn F:262   [ RasMol ]  
    Glu A:133 - Asp A:134   [ RasMol ]  
    Glu A:63 - Pro A:64   [ RasMol ]  
    Glu B:103 - Tyr B:104   [ RasMol ]  
    Glu B:133 - Asp B:134   [ RasMol ]  
    Glu B:63 - Pro B:64   [ RasMol ]  
    Glu C:133 - Asp C:134   [ RasMol ]  
    Glu C:63 - Pro C:64   [ RasMol ]  
    Glu D:133 - Asp D:134   [ RasMol ]  
    Glu D:63 - Pro D:64   [ RasMol ]  
    Glu E:133 - Asp E:134   [ RasMol ]  
    Glu E:63 - Pro E:64   [ RasMol ]  
    Glu F:133 - Asp F:134   [ RasMol ]  
    Glu F:63 - Pro F:64   [ RasMol ]  
    Gly A:199 - Phe A:200   [ RasMol ]  
    Gly A:62 - Glu A:63   [ RasMol ]  
    Gly B:199 - Phe B:200   [ RasMol ]  
    Gly B:62 - Glu B:63   [ RasMol ]  
    Gly C:199 - Phe C:200   [ RasMol ]  
    Gly C:62 - Glu C:63   [ RasMol ]  
    Gly D:199 - Phe D:200   [ RasMol ]  
    Gly D:62 - Glu D:63   [ RasMol ]  
    Gly E:199 - Phe E:200   [ RasMol ]  
    Gly E:62 - Glu E:63   [ RasMol ]  
    Gly F:199 - Phe F:200   [ RasMol ]  
    Gly F:62 - Glu F:63   [ RasMol ]  
    Gly G:486 - Gly G:487   [ RasMol ]  
    Gly G:487 - Arg G:488   [ RasMol ]  
    Gly H:486 - Gly H:487   [ RasMol ]  
    Gly H:487 - Arg H:488   [ RasMol ]  
    Gly I:486 - Gly I:487   [ RasMol ]  
    Gly I:487 - Arg I:488   [ RasMol ]  
    Thr A:184 - Gly A:185   [ RasMol ]  
    Thr B:184 - Gly B:185   [ RasMol ]  
    Thr C:184 - Gly C:185   [ RasMol ]  
    Thr D:184 - Gly D:185   [ RasMol ]  
    Thr E:184 - Gly E:185   [ RasMol ]  
    Thr F:184 - Gly F:185   [ RasMol ]  
    Tyr A:104 - Tyr A:105   [ RasMol ]  
    Tyr B:104 - Tyr B:105   [ RasMol ]  
    Tyr C:104 - Tyr C:105   [ RasMol ]  
    Tyr D:104 - Tyr D:105   [ RasMol ]  
    Tyr E:104 - Tyr E:105   [ RasMol ]  
    Tyr F:104 - Tyr F:105   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2r6c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DNAG_GEOSE | Q9X4D0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q9X4C9_GEOSE | Q9X4C9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DNAG_GEOSE | Q9X4D0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9X4C9_GEOSE | Q9X4C9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DNAG_GEOSE | Q9X4D0: 1d0q 1z8s 2r6a 4m4w
UniProtKB/TrEMBL
        Q9X4C9_GEOSE | Q9X4C9: 2r6a 2r6d 2r6e 4esv 4m4w

(-) Related Entries Specified in the PDB File

2r6a CRYSTAL FORM BH1
2r6d CRYSTAL FORM B1
2r6e CRYSTAL FORM B2