Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MYO-INOSITOL-1(OR 4)-MONOPHOSPHATASE (AQ_1983) FROM AQUIFEX AEOLICUS VF5
 
Authors :  J. Jeyakanthan, D. Gayathri, D. Velmurugan, Y. Agari, Y. Bessho, M. J. E S. V. Antonyuk, R. W. Strange, S. S. Hasnain, A. Ebihara, S. Kuramitsu, A. Shinkai, Y. Shiro, S. Yokoyama, Riken Structural Genomics/Prot Initiative (Rsgi)
Date :  30 Mar 07  (Deposition) - 02 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Myo-Inositol Monophosphatase(Impa), Bipolar Disorder, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Jeyakanthan, D. Gayathri, D. Velmurugan, Y. Agari, Y. Bessho, M. J. Ellis, S. V. Antonyuk, R. W. Strange, S. S. Hasnain, A. Ebihara, S. Kuramitsu, A. Shinkai, Y. Shiro, S. Yokoyama
Crystal Structure Of Myo-Inositol-1(Or 4)-Monophosphatase (Aq_1983) From Aquifex Aeolicus Vf5
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - INOSITOL-1-MONOPHOSPHATASE
    Chains: A, B, C, D
    EC Number: 3.1.3.25
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21A
    Expression System Strain: BL-21 CONDON PLUS (DE3)-RIL-X
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: AQUIFEX AEOLICUS
    Organism Taxid: 224324
    Strain: VF5
    Synonym: IMPASE, INOSITOL-1-PHOSPHATASE, I-1-PASE, MYO-INOSITOL-1(OR 4)-MONOPHOSPHATASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 26)

Asymmetric/Biological Unit (1, 26)
No.NameCountTypeFull Name
1MSE26Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2PCR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PCR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PCR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PCR)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IMP_1PS00629 Inositol monophosphatase family signature 1.BSUHB_AQUAE83-96
 
 
 		  4A:83-96
B:83-96
C:83-96
D:83-96

(-) Exons   (0, 0)

(no "Exon" information available for 2PCR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:238
 aligned with BSUHB_AQUAE | O67791 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:261
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262 
          BSUHB_AQUAE     3 NLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMGAEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVA 263
               SCOP domains d2pcra_ A: automated match               es                                                                                                                                                                                                                           SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh..---------------hhhhhhhhhhhhhhhhhhh...eee..--------..eeeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..eee......hhhh.eeeee.......hhhhhhhhhhhhhhhh.eee...hhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhh..eeeeee.....eeeeeehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pcr A   3 NLKKYLEVAKIAALAGGQVLKENFGK---------------SYVDKTSEERIKEVILKFFPDHEVVGE--------SEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSmRRPGAAAVDLCmVAEGIFDGmmEFEmKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYmEVA 263
                                    12        22     |   -         - |      52        62       | -      | 82        92       102       112       122       132       142       152       162       172       182 |     192   |   202  ||   212       222       232       242       252       262 
                                                    28              44                        70       79                                                                                                      184-MSE     196-MSE  205-MSE|                                               260-MSE
                                                                                                                                                                                                                                     206-MSE                                                     
                                                                                                                                                                                                                                         210-MSE                                                 


Chain B from PDB  Type:PROTEIN  Length:241
 aligned with BSUHB_AQUAE | O67791 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:263
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260   
          BSUHB_AQUAE     1 MENLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMGAEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVA 263
               SCOP domains d2pcrb_ B: automated matches                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh...--------------hhhhhhhhhhhhhhhhhhh...eee..--------...eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.......hhhh.eeeee.......hhhhhhhhhhhhhhhh.eee...hhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhh..eeeeee.....eeeeeehhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pcr B   1 mENLKKYLEVAKIAALAGGQVLKENFGKV--------------SYVDKTSEERIKEVILKFFPDHEVVGE--------SEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSmRRPGAAAVDLCmVAEGIFDGmmEFEmKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYmEVA 263
                            |       10        20        |-         -   |    50        60        70        80        90       100       110       120       130       140       150       160       170       180   |   190     | 200    || 210       220       230       240       250       260   
                            |                          29             44                        70       79                                                                                                      184-MSE     196-MSE  205-MSE|                                               260-MSE
                            1-MSE                                                                                                                                                                                                      206-MSE                                                     
                                                                                                                                                                                                                                           210-MSE                                                 


Chain C from PDB  Type:PROTEIN  Length:241
 aligned with BSUHB_AQUAE | O67791 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:263
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260   
          BSUHB_AQUAE     1 MENLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMGAEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVA 263
               SCOP domains d2pcrc_ C: automated matches                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh...-------------.hhhhhhhhhhhhhhhhhhh...eee..--------..eeeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.......hhhh.eeeee...-...hhhhhhhhhhhhhhhh.eee...hhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhh..eeeeee.....eeeeeehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pcr C   1 mENLKKYLEVAKIAALAGGQVLKENFGKV-------------VSYVDKTSEERIKEVILKFFPDHEVVGE--------SEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPS-SRRDISIYLNIFKDVFYEVGSmRRPGAAAVDLCmVAEGIFDGmmEFEmKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYmEVA 263
                            |       10        20        |-         -  |     50        60        70        80        90       100       110       120       130       140       150       160| |    170       180   |   190     | 200    || 210       220       230       240       250       260   
                            |                          29            43                         70       79                                                                               161 |                  184-MSE     196-MSE  205-MSE|                                               260-MSE
                            1-MSE                                                                                                                                                           163                                        206-MSE                                                     
                                                                                                                                                                                                                                           210-MSE                                                 


Chain D from PDB  Type:PROTEIN  Length:240
 aligned with BSUHB_AQUAE | O67791 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:261
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262 
          BSUHB_AQUAE     3 NLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFFPDHEVVGEEMGAEGSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVA 263
               SCOP domains d2pcrd_ D: automated matche            s                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh.....------------.hhhhhhhhhhhhhhhhhhhh...eee..--------..eeeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee...........hhhh.eeeee...-...hhhhhhhhhhhhhhhh.eee...hhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhh..eeeeee.....eeeeeehhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pcr D   3 NLKKYLEVAKIAALAGGQVLKENFGKV------------FVSYVDKTSEERIKEVILKFFPDHEVVGE--------SEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPS-SRRDISIYLNIFKDVFYEVGSmRRPGAAAVDLCmVAEGIFDGmmEFEmKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYmEVA 263
                                    12        22      |  -        42        52        62       | -      | 82        92       102       112       122       132       142       152        |-|      172       182 |     192   |   202  ||   212       222       232       242       252       262 
                                                     29           42                          70       79                                                                               161 |                  184-MSE     196-MSE  205-MSE|                                               260-MSE
                                                                                                                                                                                          163                                        206-MSE                                                     
                                                                                                                                                                                                                                         210-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Multi-domain proteins (alpha and beta) (2421)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2PCR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2PCR)

(-) Gene Ontology  (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (BSUHB_AQUAE | O67791)
molecular function
    GO:0042132    fructose 1,6-bisphosphate 1-phosphatase activity    Catalysis of the reaction: D-fructose 1,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008934    inositol monophosphate 1-phosphatase activity    Catalysis of the reaction: myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.
    GO:0052832    inositol monophosphate 3-phosphatase activity    Catalysis of the reaction: myo-inositol 3-phosphate + H2O = myo-inositol + phosphate.
    GO:0052833    inositol monophosphate 4-phosphatase activity    Catalysis of the reaction: myo-inositol 4-phosphate + H2O = myo-inositol + phosphate.
    GO:0052834    inositol monophosphate phosphatase activity    Catalysis of the reaction: myo-inositol phosphate + H2O = myo-inositol + phosphate.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0006094    gluconeogenesis    The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
    GO:0006020    inositol metabolic process    The chemical reactions and pathways involving inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
    GO:0046855    inositol phosphate dephosphorylation    The process of removing a phosphate group from any mono- or polyphosphorylated inositol.
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2pcr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pcr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2pcr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BSUHB_AQUAE | O67791
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.25
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BSUHB_AQUAE | O67791
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PCR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PCR)