Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF E3 UBIQUITIN-PROTEIN LIGASE ZFP91 FROM HOMO SAPIENS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET HR7784A
 
Authors :  K. Pederson, R. Shastry, E. Kohan, H. Janjua, R. Xiao, T. B. Acton, J. K. E G. T. Montelione, J. H. Prestegard, Northeast Structural Genomics Consortium (Nesg)
Date :  05 Jun 13  (Deposition) - 24 Jul 13  (Release) - 24 Jul 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Psi:Biology, C2H2, Hr7784A, Psi-Biology, Northeast Structural Genomics Consortium, Nesg, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Pederson, G. T. Montelione, J. H. Prestegard
Solution Structure Of Hr7784A
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE ZFP91
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET15_NESG
    FragmentUNP RESIDUES 370-456
    GeneFKSG11, ZFP91, ZNF757
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymZINC FINGER PROTEIN 757, ZINC FINGER PROTEIN 91 HOMOLOG, ZFP-91

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

NMR Structure (1, 3)
No.NameCountTypeFull Name
1ZN3Ligand/IonZINC ION
NMR Structure * (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION

(-) Sites  (3, 3)

NMR Structure (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:16 , CYS A:19 , HIS A:32 , HIS A:36BINDING SITE FOR RESIDUE ZN A 101
2AC2SOFTWARECYS A:74 , CYS A:77 , HIS A:90 , HIS A:95BINDING SITE FOR RESIDUE ZN A 103
3AC3SOFTWARECYS A:44 , CYS A:47 , HIS A:60 , HIS A:64BINDING SITE FOR RESIDUE ZN A 102

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2M9A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M9A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2M9A)

(-) PROSITE Motifs  (1, 3)

NMR Structure (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZINC_FINGER_C2H2_1PS00028 Zinc finger C2H2 type domain signature.ZFP91_HUMAN313-336
344-366
374-394
402-422
432-453
  3-
-
A:16-36
A:44-64
A:74-95
NMR Structure * (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZINC_FINGER_C2H2_1PS00028 Zinc finger C2H2 type domain signature.ZFP91_HUMAN313-336
344-366
374-394
402-422
432-453
  3-
-
A:16-36
A:44-64
A:74-95

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003160591aENSE00001933324chr11:58346584-58347095512ZFP91_HUMAN1-1141140--
1.2ENST000003160592ENSE00002166362chr11:58352329-5835235729ZFP91_HUMAN114-124110--
1.3ENST000003160593ENSE00002178741chr11:58377303-58377512210ZFP91_HUMAN124-194710--
1.4ENST000003160594ENSE00002148697chr11:58377771-5837780737ZFP91_HUMAN194-206130--
1.5ENST000003160595ENSE00002201708chr11:58378423-58378527105ZFP91_HUMAN206-241360--
1.6ENST000003160596ENSE00002153743chr11:58379077-58379211135ZFP91_HUMAN241-286460--
1.7ENST000003160597ENSE00002160241chr11:58379751-5837980151ZFP91_HUMAN286-303180--
1.8ENST000003160598ENSE00002146463chr11:58380235-5838031379ZFP91_HUMAN303-329270--
1.9ENST000003160599ENSE00002172201chr11:58381702-58381816115ZFP91_HUMAN330-368391A:10-101
1.10ENST0000031605910ENSE00002194467chr11:58384189-58384288100ZFP91_HUMAN368-401341A:10-4334
1.11bENST0000031605911bENSE00001254942chr11:58384669-583885153847ZFP91_HUMAN401-5701701A:43-9856

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:89
 aligned with ZFP91_HUMAN | Q96JP5 from UniProtKB/Swiss-Prot  Length:570

    Alignment length:89
                                   377       387       397       407       417       427       437       447         
          ZFP91_HUMAN   368 DQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV 456
               SCOP domains ----------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhh.....ee......ee.hhhhhhhhhhhhhh................hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   ---------ZINC_FINGER_C2H2_1    --- PROSITE
           Transcript 1 (1) Exon 1.10  PDB: A:10-43           ------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) 1--------------------------------Exon 1.11b  PDB: A:43-98 UniProt: 401-570 [INCOMPLETE]   Transcript 1 (2)
                 2m9a A  10 HMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV  98
                                    19        29        39        49        59        69        79        89         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2M9A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M9A)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M9A)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (ZFP91_HUMAN | Q96JP5)
molecular function
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0007250    activation of NF-kappaB-inducing kinase activity    The stimulation of the activity of NF-kappaB-inducing kinase through phosphorylation at specific residues.
    GO:0070534    protein K63-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 63 of the ubiquitin monomers, is added to a protein. K63-linked ubiquitination does not target the substrate protein for degradation, but is involved in several pathways, notably as a signal to promote error-free DNA postreplication repair.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m9a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m9a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ZFP91_HUMAN | Q96JP5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ZFP91_HUMAN | Q96JP5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2M9A)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2M9A)