Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF ALK1 EXTRACELLULAR DOMAIN
 
Authors :  U. Ilangovan
Date :  06 May 11  (Deposition) - 25 Jul 12  (Release) - 25 Jul 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Mahlawat, U. Ilangovan, A. Hinck
Nmr Solution Structure Of Alk1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ACTIVIN RECEPTOR-LIKE KINASE 1
    Chains: A
    EC Number: 2.7.11.30
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET15B
    Fragment: EXTRACELLULAR DOMAIN RESIDUES 22-118
    Gene: ACVRL1, ACVRLK1, ALK1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: SERINE/THREONINE-PROTEIN KINASE RECEPTOR R3, SKR3, ALK-1, TGF-B SUPERFAMILY RECEPTOR TYPE I, TSR-I

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LCR)

(-) Sites  (0, 0)

(no "Site" information available for 2LCR)

(-) SS Bonds  (5, 5)

NMR Structure
No.Residues
1A:13 -A:30
2A:15 -A:20
3A:25 -A:48
4A:56 -A:68
5A:69 -A:74

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LCR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (22, 22)

NMR Structure (22, 22)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_070308P30SACVL1_HUMANUnclassified149664056AP9S
02UniProtVAR_070309C34YACVL1_HUMANDisease (HHT2)  ---AC13Y
03UniProtVAR_070310S38CACVL1_HUMANPolymorphism  ---AS17C
04UniProtVAR_075231C41GACVL1_HUMANDisease (HHT2)  ---AC20G
05UniProtVAR_075232C41YACVL1_HUMANDisease (HHT2)  ---AC20Y
06UniProtVAR_075233C46GACVL1_HUMANDisease (HHT2)  ---AC25G
07UniProtVAR_075234R47PACVL1_HUMANDisease (HHT2)  ---AR26P
08UniProtVAR_026785G48RACVL1_HUMANDisease (HHT2)  ---AG27R
09UniProtVAR_006204W50CACVL1_HUMANDisease (HHT2)121909285AW29C
10UniProtVAR_070311W50GACVL1_HUMANDisease (HHT2)  ---AW29G
11UniProtVAR_006205C51YACVL1_HUMANDisease (HHT2)863223409AC30Y
12UniProtVAR_070312T52AACVL1_HUMANDisease (HHT2)  ---AT31A
13UniProtVAR_070313H66PACVL1_HUMANDisease (HHT2)  ---AH45P
14UniProtVAR_075235H66YACVL1_HUMANDisease (HHT2)  ---AH45Y
15UniProtVAR_006206R67QACVL1_HUMANDisease (HHT2)863223414AR46Q
16UniProtVAR_026786R67WACVL1_HUMANDisease (HHT2)  ---AR46W
17UniProtVAR_070314C69RACVL1_HUMANDisease (HHT2)  ---AC48R
18UniProtVAR_075236C77FACVL1_HUMANDisease (HHT2)  ---AC56F
19UniProtVAR_006207C77WACVL1_HUMANDisease (HHT2)  ---AC56W
20UniProtVAR_006208N96DACVL1_HUMANDisease (HHT2)  ---AN75D
21UniProtVAR_070315N96SACVL1_HUMANDisease (HHT2)  ---AN75S
22UniProtVAR_075237E111DACVL1_HUMANPolymorphism  ---AE90D
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (22, 22)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_070308P30SACVL1_HUMANUnclassified149664056AP9S
02UniProtVAR_070309C34YACVL1_HUMANDisease (HHT2)  ---AC13Y
03UniProtVAR_070310S38CACVL1_HUMANPolymorphism  ---AS17C
04UniProtVAR_075231C41GACVL1_HUMANDisease (HHT2)  ---AC20G
05UniProtVAR_075232C41YACVL1_HUMANDisease (HHT2)  ---AC20Y
06UniProtVAR_075233C46GACVL1_HUMANDisease (HHT2)  ---AC25G
07UniProtVAR_075234R47PACVL1_HUMANDisease (HHT2)  ---AR26P
08UniProtVAR_026785G48RACVL1_HUMANDisease (HHT2)  ---AG27R
09UniProtVAR_006204W50CACVL1_HUMANDisease (HHT2)121909285AW29C
10UniProtVAR_070311W50GACVL1_HUMANDisease (HHT2)  ---AW29G
11UniProtVAR_006205C51YACVL1_HUMANDisease (HHT2)863223409AC30Y
12UniProtVAR_070312T52AACVL1_HUMANDisease (HHT2)  ---AT31A
13UniProtVAR_070313H66PACVL1_HUMANDisease (HHT2)  ---AH45P
14UniProtVAR_075235H66YACVL1_HUMANDisease (HHT2)  ---AH45Y
15UniProtVAR_006206R67QACVL1_HUMANDisease (HHT2)863223414AR46Q
16UniProtVAR_026786R67WACVL1_HUMANDisease (HHT2)  ---AR46W
17UniProtVAR_070314C69RACVL1_HUMANDisease (HHT2)  ---AC48R
18UniProtVAR_075236C77FACVL1_HUMANDisease (HHT2)  ---AC56F
19UniProtVAR_006207C77WACVL1_HUMANDisease (HHT2)  ---AC56W
20UniProtVAR_006208N96DACVL1_HUMANDisease (HHT2)  ---AN75D
21UniProtVAR_070315N96SACVL1_HUMANDisease (HHT2)  ---AN75S
22UniProtVAR_075237E111DACVL1_HUMANPolymorphism  ---AE90D
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LCR)

(-) Exons   (0, 0)

(no "Exon" information available for 2LCR)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with ACVL1_HUMAN | P37023 from UniProtKB/Swiss-Prot  Length:503

    Alignment length:97
                                    31        41        51        61        71        81        91       101       111       
          ACVL1_HUMAN    22 DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ 118
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh..eeee.........eeee..eeeeee.......eeeeee....hhhhh.......eeeee...hhhhh.................... Sec.struct. author
             SAPs(SNPs) (1) --------S---Y---C--G----GPR-CYA-------------PQ-R-------F------------------D--------------D------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------Y--------G---------------YW---------W------------------S---------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2lcr A   1 DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ  97
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LCR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LCR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LCR)

(-) Gene Ontology  (73, 73)

NMR Structure(hide GO term definitions)
Chain A   (ACVL1_HUMAN | P37023)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0098821    BMP receptor activity    Combining with a member of the bone morphogenetic protein (BMP) family, and transmitting a signal across the plasma membrane to initiate a change in cell activity.
    GO:0046332    SMAD binding    Interacting selectively and non-covalently with a SMAD signaling protein.
    GO:0048185    activin binding    Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
    GO:0016361    activin receptor activity, type I    Combining with activin-bound type II activin receptor to initiate a change in cell activity; upon binding, acts as a downstream transducer of activin signals.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004702    signal transducer, downstream of receptor, with serine/threonine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0050431    transforming growth factor beta binding    Interacting selectively and non-covalently with TGF-beta, transforming growth factor beta, a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types.
    GO:0005025    transforming growth factor beta receptor activity, type I    Combining with a complex of transforming growth factor beta and a type II TGF-beta receptor to initiate a change in cell activity; upon binding, acts as a downstream transducer of TGF-beta signals.
    GO:0005024    transforming growth factor beta-activated receptor activity    Combining with a transforming growth factor beta (TGFbeta) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004675    transmembrane receptor protein serine/threonine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0032924    activin receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to an activin receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0060840    artery development    The progression of the artery over time, from its initial formation to the mature structure. An artery is a blood vessel that carries blood away from the heart to a capillary bed.
    GO:0008015    blood circulation    The flow of blood through the body of an animal, enabling the transport of nutrients to the tissues and the removal of waste products.
    GO:0002043    blood vessel endothelial cell proliferation involved in sprouting angiogenesis    The multiplication or reproduction of blood vessel endothelial cells, resulting in the expansion of a cell population contributing to sprouting angiogenesis.
    GO:0001955    blood vessel maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a blood vessel to attain its fully functional state.
    GO:0048514    blood vessel morphogenesis    The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
    GO:0001974    blood vessel remodeling    The reorganization or renovation of existing blood vessels.
    GO:0071773    cellular response to BMP stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0061154    endothelial tube morphogenesis    The process in which the anatomical structures of a tube are generated and organized from an endothelium. Endothelium refers to the layer of cells lining blood vessels, lymphatics, the heart, and serous cavities, and is derived from bone marrow or mesoderm. Corneal endothelium is a special case, derived from neural crest cells.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0001946    lymphangiogenesis    Lymph vessel formation when new vessels emerge from the proliferation of pre-existing vessels.
    GO:0060836    lymphatic endothelial cell differentiation    The process in which a venous blood vessel endothelial cell acquires specialized features of a lymphatic vessel endothelial cell, a thin flattened cell that lines the inside surfaces of lymph vessels.
    GO:2000279    negative regulation of DNA biosynthetic process    Any process that stops, prevents or reduces the frequency, rate or extent of DNA biosynthetic process.
    GO:0043537    negative regulation of blood vessel endothelial cell migration    Any process that stops, prevents, or reduces the frequency, rate or extent of the migration of the endothelial cells of blood vessels.
    GO:0007162    negative regulation of cell adhesion    Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0030336    negative regulation of cell migration    Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0045602    negative regulation of endothelial cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of endothelial cell differentiation.
    GO:0010596    negative regulation of endothelial cell migration    Any process that decreases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
    GO:0001937    negative regulation of endothelial cell proliferation    Any process that stops, prevents, or reduces the rate or extent of endothelial cell proliferation.
    GO:0051895    negative regulation of focal adhesion assembly    Any process that stops, prevents, or reduces the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0030513    positive regulation of BMP signaling pathway    Any process that activates or increases the frequency, rate or extent of BMP signaling pathway activity.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0032332    positive regulation of chondrocyte differentiation    Any process that activates or increases the frequency, rate or extent of chondrocyte differentiation.
    GO:0045603    positive regulation of endothelial cell differentiation    Any process that activates or increases the frequency, rate or extent of endothelial cell differentiation.
    GO:0001938    positive regulation of endothelial cell proliferation    Any process that activates or increases the rate or extent of endothelial cell proliferation.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0051291    protein heterooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0006275    regulation of DNA replication    Any process that modulates the frequency, rate or extent of DNA replication.
    GO:0008217    regulation of blood pressure    Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
    GO:0043535    regulation of blood vessel endothelial cell migration    Any process that modulates the frequency, rate or extent of the migration of the endothelial cells of blood vessels.
    GO:0001936    regulation of endothelial cell proliferation    Any process that modulates the frequency, rate, or extent of endothelial cell proliferation.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0061298    retina vasculature development in camera-type eye    The process whose specific outcome is the progression of the vasculature of the retina over time, from its formation to the mature structure.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007178    transmembrane receptor protein serine/threonine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0060841    venous blood vessel development    The progression of the venous blood vessel over time from its initial formation to the mature structure. Venous blood vessels carry blood back to the heart after the capillary bed.
    GO:0035313    wound healing, spreading of epidermal cells    The migration of an epidermal cell along or through a wound gap that contributes to the reestablishment of a continuous epidermis.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lcr)
 
  Sites
(no "Sites" information available for 2lcr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lcr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lcr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACVL1_HUMAN | P37023
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.30
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  600376
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ACVL1_HUMAN | P37023
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACVL1_HUMAN | P37023: 3my0 4fao

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LCR)