Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF HUMAN UBIQUITIN SPECIFIC PROTEASE USP7 UBL DOMAIN (RESIDUES 537-664). NESG TARGET HR4395C/ SGC-TORONTO
 
Authors :  I. Bezsonova, A. Lemak, G. Avvakumov, S. Xue, S. Dhe-Paganon, G. T. Mont C. Arrowsmith, Northeast Structural Genomics Consortium (Nesg Structural Genomics Consortium (Sgc)
Date :  25 Mar 10  (Deposition) - 21 Apr 10  (Release) - 23 May 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Usp7, Ubiquitin-Like Domain, Ubl, Ubiquitin Specific Protease, Host- Virus Interaction, Hydrolase, Nucleus, Protease, Thiol Protease, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Sgc, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Bezsonova, A. Lemak, G. Avvakumov, S. Xue, S. Dhe-Paganon, G. T. Montelione, C. Arrowsmith
Solution Structure Of The Ubiquitin Specific Protease Usp7 Ubiquitin-Like Domain
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7
    ChainsA
    EC Number3.1.2.15
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUBIQUITIN-LIKE DOMAIN (RESIDUES 537-664)
    GeneUSP7, HAUSP
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN THIOESTERASE 7, UBIQUITIN-SPECIFIC-PROCESSING PROTEASE 7, DEUBIQUITINATING ENZYME 7, HERPESVIRUS-ASSOCIATED UBIQUITIN-SPECIFIC PROTEASE

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KVR)

(-) Sites  (0, 0)

(no "Site" information available for 2KVR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KVR)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Asn A:120 -Pro A:121

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KVR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KVR)

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003448361ENSE00001413420chr16:9057341-9057064278UBP7_HUMAN1-27270--
1.3ENST000003448363ENSE00001363956chr16:9024254-9024150105UBP7_HUMAN27-62360--
1.4ENST000003448364ENSE00001368599chr16:9017270-9017072199UBP7_HUMAN62-128670--
1.5ENST000003448365ENSE00001378973chr16:9015152-9015014139UBP7_HUMAN128-174470--
1.6ENST000003448366ENSE00001384498chr16:9014304-901421689UBP7_HUMAN175-204300--
1.7ENST000003448367ENSE00001364655chr16:9012996-9012888109UBP7_HUMAN204-240370--
1.8ENST000003448368ENSE00001371018chr16:9011013-9010883131UBP7_HUMAN241-284440--
1.9ENST000003448369ENSE00001378062chr16:9010413-901035955UBP7_HUMAN284-302190--
1.10ENST0000034483610ENSE00001382791chr16:9009382-900930281UBP7_HUMAN303-329270--
1.11ENST0000034483611ENSE00001382051chr16:9009201-900911191UBP7_HUMAN330-360310--
1.12ENST0000034483612ENSE00001364905chr16:9004684-900460283UBP7_HUMAN360-387280--
1.13ENST0000034483613ENSE00001369206chr16:9002307-9002198110UBP7_HUMAN388-424370--
1.14ENST0000034483614ENSE00001370062chr16:9000439-9000283157UBP7_HUMAN424-476530--
1.15ENST0000034483615ENSE00001386233chr16:8999188-8999044145UBP7_HUMAN477-525490--
1.16ENST0000034483616ENSE00001369997chr16:8998422-8998292131UBP7_HUMAN525-568441A:1-3232
1.17ENST0000034483617ENSE00001373075chr16:8997259-8997125135UBP7_HUMAN569-613451A:33-7745
1.18ENST0000034483618ENSE00001385270chr16:8996339-8996238102UBP7_HUMAN614-647341A:78-11134
1.19ENST0000034483619ENSE00001366300chr16:8996044-8995939106UBP7_HUMAN648-683361A:112-12817
1.20ENST0000034483620ENSE00001403793chr16:8995091-899499993UBP7_HUMAN683-714320--
1.21ENST0000034483621ENSE00001416021chr16:8994914-899484768UBP7_HUMAN714-736230--
1.22ENST0000034483622ENSE00001413036chr16:8994487-8994387101UBP7_HUMAN737-770340--
1.23ENST0000034483623ENSE00001425600chr16:8993614-8993461154UBP7_HUMAN770-821520--
1.24ENST0000034483624ENSE00001432172chr16:8993045-899297868UBP7_HUMAN822-844230--
1.25ENST0000034483625ENSE00001431013chr16:8992496-8992388109UBP7_HUMAN844-880370--
1.26ENST0000034483626ENSE00001407007chr16:8992294-899221778UBP7_HUMAN881-906260--
1.27ENST0000034483627ENSE00001504725chr16:8990956-8990856101UBP7_HUMAN907-940340--
1.28ENST0000034483628ENSE00001504724chr16:8989598-8989499100UBP7_HUMAN940-973340--
1.29ENST0000034483629ENSE00001423657chr16:8989007-8988888120UBP7_HUMAN974-1013400--
1.30ENST0000034483630ENSE00001428927chr16:8988712-898864172UBP7_HUMAN1014-1037240--
1.31ENST0000034483631ENSE00001400057chr16:8988497-898840791UBP7_HUMAN1038-1068310--
1.32bENST0000034483632bENSE00001404180chr16:8987961-89859512011UBP7_HUMAN1068-1102350--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:128
 aligned with UBP7_HUMAN | Q93009 from UniProtKB/Swiss-Prot  Length:1102

    Alignment length:128
                                   546       556       566       576       586       596       606       616       626       636       646       656        
           UBP7_HUMAN   537 PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET 664
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains USP7-2kvrA01 A:1-30           -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh..........eeeee.....................eeee.....hhhhhhhhhhhhhh.hhhhheeee................hhhhh..hhhhhh....eeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.16  PDB: A:1-32          Exon 1.17  PDB: A:33-77 UniProt: 569-613     Exon 1.18  PDB: A:78-111          Exon 1.19         Transcript 1
                 2kvr A   1 PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KVR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KVR)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (30, 30)

NMR Structure(hide GO term definitions)
Chain A   (UBP7_HUMAN | Q93009)
molecular function
    GO:0004197    cysteine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0002039    p53 binding    Interacting selectively and non-covalently with one of the p53 family of proteins.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004843    thiol-dependent ubiquitin-specific protease activity    Catalysis of the thiol-dependent hydrolysis of a peptide bond formed by the C-terminal glycine of ubiquitin and another protein.
    GO:0036459    thiol-dependent ubiquitinyl hydrolase activity    Catalysis of the thiol-dependent hydrolysis of an ester, thioester, amide, peptide or isopeptide bond formed by the C-terminal glycine of ubiquitin.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0010216    maintenance of DNA methylation    Any process involved in maintaining the methylation state of a nucleotide sequence.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0032088    negative regulation of NF-kappaB transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
    GO:0016579    protein deubiquitination    The removal of one or more ubiquitin groups from a protein.
    GO:0050821    protein stabilization    Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051090    regulation of sequence-specific DNA binding transcription factor activity    Any process that modulates the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:1904353    regulation of telomere capping    Any process that modulates the frequency, rate or extent of telomere capping.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016604    nuclear body    Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kvr)
 
  Sites
(no "Sites" information available for 2kvr)
 
  Cis Peptide Bonds
    Asn A:120 - Pro A:121   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kvr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UBP7_HUMAN | Q93009
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.2.15
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  UBP7_HUMAN | Q93009
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UBP7_HUMAN | Q930091nb8 1nbf 1yy6 1yze 2f1w 2f1x 2f1y 2f1z 2foj 2foo 2fop 2xxn 2ylm 3mqr 3mqs 4jjq 4kg9 4m5w 4m5x 4pyz 4wph 4wpi 4yoc 4ysi 4z96 4z97 5c56 5c6d 5fwi 5gg4 5j7t 5jtj 5jtv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KVR)