2JTB - JenaLib

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A01_HAPHA | D2Y1X9 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A01_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------- PROSITE (7)
                PROSITE (8) -HWTX_1  PDB: A:2-29         ---- PROSITE (8)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A02_HAPHA | D2Y1Y0 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A02_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) -HWTX_1  PDB: A:2-29         ---- PROSITE (6)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A03_HAPHA | D2Y1Y1 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A03_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) -HWTX_1  PDB: A:2-29         ---- PROSITE (2)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A04_HAPHA | D2Y1Y2 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A04_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------- PROSITE (10)
               PROSITE (11) -HWTX_1  PDB: A:2-29         ---- PROSITE (11)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A05_HAPHA | D2Y1Y3 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A05_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) -HWTX_1  PDB: A:2-29         ---- PROSITE (3)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A06_HAPHA | D2Y1Z4 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A06_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) -HWTX_1  PDB: A:2-29         ---- PROSITE (4)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A07_HAPHA | D2Y1Z7 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A07_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------- PROSITE (8)
                PROSITE (9) -HWTX_1  PDB: A:2-29         ---- PROSITE (9)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A08_HAPHA | D2Y1Z8 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A08_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) -HWTX_1  PDB: A:2-29         ---- PROSITE (5)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A09_HAPHA | D2Y2D1 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A09_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------- PROSITE (9)
               PROSITE (10) -HWTX_1  PDB: A:2-29         ---- PROSITE (10)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A10_HAPHA | D2Y2D2 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A10_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) -HWTX_1  PDB: A:2-29         ---- PROSITE (7)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A11_HAPHA | D2Y2D3 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A11_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------- PROSITE (8)
                PROSITE (9) --------------------------------- PROSITE (9)
               PROSITE (10) --------------------------------- PROSITE (10)
               PROSITE (11) --------------------------------- PROSITE (11)
               PROSITE (12) -HWTX_1  PDB: A:2-29         ---- PROSITE (12)
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with H3A12_HAPHA | D2Y2I3 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:33
                                    58        68        78   
           H3A12_HAPHA   49 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 81
               SCOP domains d2jtba_ A: automated matches      SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....................ee......ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE -HWTX_1  PDB: A:2-29         ---- PROSITE
                 Transcript --------------------------------- Transcript
                  2jtb A  1 GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL 33
                                    10        20        30

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (4, 48)

NMR Structure(hide GO term definitions)

Chain A (H3A08_HAPHA | D2Y1Z8)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A05_HAPHA | D2Y1Y3)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A07_HAPHA | D2Y1Z7)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A09_HAPHA | D2Y2D1)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A06_HAPHA | D2Y1Z4)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A12_HAPHA | D2Y2I3)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A02_HAPHA | D2Y1Y0)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A01_HAPHA | D2Y1X9)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A10_HAPHA | D2Y2D2)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A03_HAPHA | D2Y1Y1)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A11_HAPHA | D2Y2D3)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Chain A (H3A04_HAPHA | D2Y1Y2)

molecular function
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0072556	other organism presynaptic membrane	A presynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A presynaptic membrane is specialized area of membrane of the axon terminal that faces the plasma membrane of the neuron or muscle fiber with which the axon terminal establishes a synaptic junction; many synaptic junctions exhibit structural presynaptic characteristics, such as conical, electron-dense internal protrusions, that distinguish it from the remainder of the axon plasma membrane.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2jtb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	H3A01_HAPHA \| D2Y1X9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A02_HAPHA \| D2Y1Y0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A03_HAPHA \| D2Y1Y1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A04_HAPHA \| D2Y1Y2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A05_HAPHA \| D2Y1Y3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A06_HAPHA \| D2Y1Z4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A07_HAPHA \| D2Y1Z7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A08_HAPHA \| D2Y1Z8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A09_HAPHA \| D2Y2D1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A10_HAPHA \| D2Y2D2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A11_HAPHA \| D2Y2D3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	H3A12_HAPHA \| D2Y2I3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments