Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  STRUCTURE MODEL OF HUMAN ARYLAMINE N-ACETYLTRANSFERASE 1
 
Authors :  N. Zhang, L. Liu, F. Liu, C. R. Wagner, P. E. Hanna, K. J. Walters
Date :  07 May 06  (Deposition) - 19 Sep 06  (Release) - 31 Oct 06  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Alpha-Helix Beta-Sheet Scaffold (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Zhang, L. Liu, F. Liu, C. R. Wagner, P. E. Hanna, K. J. Walters
Nmr-Based Model Reveals The Structural Determinants Of Mammalian Arylamine N-Acetyltransferase Substrate Specificity.
J. Mol. Biol. V. 363 188 2006
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ARYLAMINE N-ACETYLTRANSFERASE 1
    ChainsA
    EC Number2.3.1.5
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    SynonymARYLAMIDE ACETYLASE 1, ARYLAMINE N- ACETYLTRANSFERASE, MONOMORPHIC, MNAT, N-ACETYLTRANSFERASE TYPE 1, NAT-1

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GWU)

(-) Sites  (0, 0)

(no "Site" information available for 2GWU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GWU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GWU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (10, 10)

Theoretical Model (10, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_004606R64WARY1_HUMANPolymorphism56379106AR64W
02UniProtVAR_009510R117TARY1_HUMANPolymorphism55641436AR117T
03UniProtVAR_004607V149IARY1_HUMANPolymorphism4987076AV149I
04UniProtVAR_009069R187QARY1_HUMANPolymorphism4986782AR187Q
05UniProtVAR_009070M205VARY1_HUMANPolymorphism72554609AM205V
06UniProtVAR_020384T207IARY1_HUMANPolymorphism4987195AT207I
07UniProtVAR_009071S214AARY1_HUMANPolymorphism4986783AS214A
08UniProtVAR_009072D251VARY1_HUMANPolymorphism56172717AD251V
09UniProtVAR_009073E261KARY1_HUMANPolymorphism72554610AE261K
10UniProtVAR_009074I263VARY1_HUMANPolymorphism72554611AI263V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GWU)

(-) Exons   (1, 1)

Theoretical Model (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.4aENST000003077194aENSE00001354189chr8:18067602-1806768988ARY1_HUMAN-00--
1.8ENST000003077198ENSE00001146057chr8:18076920-1807699879ARY1_HUMAN-00--
1.9eENST000003077199eENSE00001308408chr8:18079551-180811981648ARY1_HUMAN1-2922921A:1-290290

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:290
 aligned with ARY1_HUMAN | P18440 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:290
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290
           ARY1_HUMAN     1 MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI 290
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh........hhhhhhhhhhhhhhhh.eehhhhhh......hhhhhhhhhh......hhhhhhhhhhhhhhhhh.eeeeeeeee.............eeeeeeee..eeeee.............ee.....ee......eeeee....eeeeeee...................eeeeeeee.....hhhhhhhhhhhhhhh..hhhhhh.eee......eeeee..eeeeee.....eeeee.....hhhhhhhhhhhh...hhhhhh..hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------W----------------------------------------------------T-------------------------------I-------------------------------------Q-----------------V-I------A------------------------------------V---------K-V--------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.9e  PDB: A:1-290 UniProt: 1-292 [INCOMPLETE]                                                                                                                                                                                                                                                Transcript 1
                 2gwu A   1 MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI 290
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2GWU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2GWU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GWU)

(-) Gene Ontology  (8, 8)

Theoretical Model(hide GO term definitions)
Chain A   (ARY1_HUMAN | P18440)
molecular function
    GO:0016407    acetyltransferase activity    Catalysis of the transfer of an acetyl group to an acceptor molecule.
    GO:0004060    arylamine N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + an arylamine = CoA + an N-acetylarylamine.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006805    xenobiotic metabolic process    The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gwu)
 
  Sites
(no "Sites" information available for 2gwu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gwu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gwu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARY1_HUMAN | P18440
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ARY1_HUMAN | P18440
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARY1_HUMAN | P184402dss 2ija 2pqt

(-) Related Entries Specified in the PDB File

1e2t CRYSTAL STRUCTURE OF ARYLAMINE N-ACETYLTRANSFERASE (NAT) FROM SALMONELLA TYPHIMURIUM
1gx3 CRYSTAL STRUCTURE OF M. SMEGMATIS ARYLAMINE N- ACETYLTRANSFERASE