Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE TRANS-ACTIVATION DOMAIN OF THE HUMAN CO-ACTIVATOR ARC105
 
Authors :  B. W. Vought, Z. -Y. Jim Sun, S. G. Hyberts, G. Wagner, A. M. Naar
Date :  01 May 06  (Deposition) - 08 Aug 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
Keywords :  Kix, 3 Helical Bundle, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Yang, B. W. Vought, J. S. Satterlee, A. K. Walker, Z. -Y. Jim Sun, J. L. Watts, R. Debeaumont, R. Mako Saito, S. G. Hyberts, S. Yang, C. Macol, L. Iyer, R. Tjian, S. Van Den Heuvel, A. C. Hart, G. Wagner, A. M. Naar
An Arc/Mediator Subunit Required For Srebp Control Of Cholesterol And Lipid Homeostasis.
Nature V. 442 700 2006
PubMed-ID: 16799563  |  Reference-DOI: 10.1038/NATURE04942
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ARC/MEDIATOR, POSITIVE COFACTOR 2 GLUTAMINE/Q- RICH-ASSOCIATED PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET24
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentARC/MEDIATOR KIX DOMAIN, RESIDUES 5-78
    GenePCQAP, ARC105, CTG7A, TIG1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPC2 GLUTAMINE/Q-RICH-ASSOCIATED PROTEIN, TPA- INDUCIBLE GENE 1 PROTEIN, TIG-1, ACTIVATOR-RECRUITED COFACTOR 105 KDA COMPONENT, ARC105, CTG REPEAT PROTEIN 7A

 Structural Features

(-) Chains, Units

  
NMR Structure (15x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GUT)

(-) Sites  (0, 0)

(no "Site" information available for 2GUT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GUT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GUT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GUT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GUT)

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3hENST000002632053hENSE00001871169chr22:20861897-20862033137MED15_HUMAN1-23231A:2-2322
1.8bENST000002632058bENSE00001630596chr22:20891404-2089149188MED15_HUMAN23-52301A:23-5230
1.10bENST0000026320510bENSE00001603683chr22:20905723-2090577452MED15_HUMAN53-70181A:53-7018
1.12bENST0000026320512bENSE00001731887chr22:20907432-2090746130MED15_HUMAN70-80111A:70-789
1.13fENST0000026320513fENSE00002170225chr22:20909223-20909435213MED15_HUMAN80-151720--
1.14jENST0000026320514jENSE00001604794chr22:20918737-20918975239MED15_HUMAN151-230800--
1.15fENST0000026320515fENSE00001667200chr22:20920754-20921104351MED15_HUMAN231-3471170--
1.16ENST0000026320516ENSE00001601230chr22:20922808-20922918111MED15_HUMAN348-384370--
1.17bENST0000026320517bENSE00001309980chr22:20929400-20929519120MED15_HUMAN385-424400--
1.18cENST0000026320518cENSE00001677957chr22:20936898-20937034137MED15_HUMAN425-470460--
1.18eENST0000026320518eENSE00001760853chr22:20937127-20937254128MED15_HUMAN470-513440--
1.18hENST0000026320518hENSE00001678021chr22:20937400-20937534135MED15_HUMAN513-558460--
1.19aENST0000026320519aENSE00001762650chr22:20937617-2093768064MED15_HUMAN558-579220--
1.19eENST0000026320519eENSE00001697486chr22:20938646-2093871267MED15_HUMAN579-601230--
1.19fENST0000026320519fENSE00001791645chr22:20939142-20939302161MED15_HUMAN602-655540--
1.19hENST0000026320519hENSE00001598061chr22:20939388-20939554167MED15_HUMAN655-711570--
1.19kENST0000026320519kENSE00001610497chr22:20940015-2094011399MED15_HUMAN711-744340--
1.20cENST0000026320520cENSE00001809726chr22:20940855-209419061052MED15_HUMAN744-788450--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:77
 aligned with MED15_HUMAN | Q96RN5 from UniProtKB/Swiss-Prot  Length:788

    Alignment length:77
                                    11        21        31        41        51        61        71       
           MED15_HUMAN    2 DVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASV 78
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3h  PDB: A:2-23-----------------------------Exon 1.10b        -------- Transcript 1 (1)
           Transcript 1 (2) ---------------------Exon 1.8b  PDB: A:23-52       -----------------1.12b     Transcript 1 (2)
                  2gut A  2 GAMGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASV 78
                                    11        21        31        41        51        61        71       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2GUT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2GUT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GUT)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)
Chain A   (MED15_HUMAN | Q96RN5)
molecular function
    GO:0001104    RNA polymerase II transcription cofactor activity    Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to modulate transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between regulatory transcription factors and the basal RNAP II transcription machinery.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016592    mediator complex    A protein complex that interacts with the carboxy-terminal domain of the largest subunit of RNA polymerase II and plays an active role in transducing the signal from a transcription factor to the transcriptional machinery. The mediator complex is required for activation of transcription of most protein-coding genes, but can also act as a transcriptional corepressor. The Saccharomyces complex contains several identifiable subcomplexes: a head domain comprising Srb2, -4, and -5, Med6, -8, and -11, and Rox3 proteins; a middle domain comprising Med1, -4, and -7, Nut1 and -2, Cse2, Rgr1, Soh1, and Srb7 proteins; a tail consisting of Gal11p, Med2p, Pgd1p, and Sin4p; and a regulatory subcomplex comprising Ssn2, -3, and -8, and Srb8 proteins. Metazoan mediator complexes have similar modular structures and include homologs of yeast Srb and Med proteins.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gut)
 
  Sites
(no "Sites" information available for 2gut)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gut)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gut
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MED15_HUMAN | Q96RN5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MED15_HUMAN | Q96RN5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GUT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GUT)