Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF HUMAN GLUTATHIONE S-TRANSFERASE M1A-1A COMPLEXED WITH 1-(S-(GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXADIENATE ANION
 
Authors :  Y. Patskovsky, L. Patskovska, S. C. Almo, I. Listowsky
Date :  21 Nov 05  (Deposition) - 25 Apr 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Keywords :  Transferase, Glutathione, Conjugation, Detoxification, Cytosolic, Dimer, Active Site, Transition State Analogue (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Patskovsky, L. Patskovska, S. C. Almo, I. Listowsky
Transition State Model And Mechanism Of Nucleophilic Aromatic Substitution Reactions Catalyzed By Human Glutathione S-Transferase M1A-1A.
Biochemistry V. 45 3852 2006
PubMed-ID: 16548513  |  Reference-DOI: 10.1021/BI051823+
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE MU 1
    ChainsA, B, C, D, E, F
    EC Number2.5.1.18
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET3A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneGSTM1, GST1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGSTM1-1, GST CLASS-MU 1, GSTM1A-1A, GSTM1B-1B, HB SUBUNIT 4, GTH4

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)AB    
Biological Unit 2 (1x)  CD  
Biological Unit 3 (1x)    EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
1GTD6Ligand/Ion1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1GTD2Ligand/Ion1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1GTD2Ligand/Ion1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1GTD2Ligand/Ion1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:6 , TRP A:7 , GLY A:11 , LEU A:12 , ARG A:42 , TRP A:45 , LYS A:49 , ASN A:58 , LEU A:59 , PRO A:60 , GLN A:71 , SER A:72 , MET A:104 , TYR A:115 , PHE A:208 , HOH A:1219 , HOH A:1222 , HOH A:1223 , HOH A:1224 , ASP B:105BINDING SITE FOR RESIDUE GTD A 1218
2AC2SOFTWAREASP A:105 , TYR B:6 , TRP B:7 , LEU B:12 , ARG B:42 , TRP B:45 , LYS B:49 , ASN B:58 , LEU B:59 , PRO B:60 , GLN B:71 , SER B:72 , HIS B:107 , MET B:108 , TYR B:115 , PHE B:208 , HOH B:2219 , HOH B:2223BINDING SITE FOR RESIDUE GTD B 2218
3AC3SOFTWARETYR C:6 , TRP C:7 , ILE C:9 , GLY C:11 , LEU C:12 , ARG C:42 , TRP C:45 , LYS C:49 , ASN C:58 , LEU C:59 , PRO C:60 , GLN C:71 , SER C:72 , HIS C:107 , TYR C:115 , PHE C:208 , HOH C:3220 , HOH C:3223 , ASP D:105BINDING SITE FOR RESIDUE GTD C 3218
4AC4SOFTWAREASP C:105 , TYR D:6 , TRP D:7 , ILE D:9 , GLY D:11 , LEU D:12 , ARG D:42 , TRP D:45 , LYS D:49 , ASN D:58 , LEU D:59 , PRO D:60 , GLN D:71 , SER D:72 , MET D:108 , GLY D:111 , TYR D:115 , PHE D:208 , HOH D:4224BINDING SITE FOR RESIDUE GTD D 4218
5AC5SOFTWARETRP E:7 , LEU E:12 , ARG E:42 , TRP E:45 , LYS E:49 , ASN E:58 , LEU E:59 , GLN E:71 , SER E:72 , MET E:104 , HIS E:107 , MET E:108 , TYR E:115 , PHE E:208 , HOH E:5219 , HOH E:5221 , ASP F:105BINDING SITE FOR RESIDUE GTD E 5218
6AC6SOFTWAREASP E:105 , TRP F:7 , LEU F:12 , TRP F:45 , LYS F:49 , ASN F:58 , LEU F:59 , PRO F:60 , GLN F:71 , SER F:72 , HIS F:107 , MET F:108 , TYR F:115 , PHE F:208BINDING SITE FOR RESIDUE GTD F 6218

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:77 -A:86
2B:77 -B:86
3C:77 -C:86
4D:77 -D:86
5E:77 -E:86
6F:77 -F:86

(-) Cis Peptide Bonds  (18, 18)

Asymmetric Unit
No.Residues
1Ala A:37 -Pro A:38
2Leu A:59 -Pro A:60
3Arg A:205 -Pro A:206
4Ala B:37 -Pro B:38
5Leu B:59 -Pro B:60
6Arg B:205 -Pro B:206
7Ala C:37 -Pro C:38
8Leu C:59 -Pro C:60
9Arg C:205 -Pro C:206
10Ala D:37 -Pro D:38
11Leu D:59 -Pro D:60
12Arg D:205 -Pro D:206
13Ala E:37 -Pro E:38
14Leu E:59 -Pro E:60
15Arg E:205 -Pro E:206
16Ala F:37 -Pro F:38
17Leu F:59 -Pro F:60
18Arg F:205 -Pro F:206

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 12)

Asymmetric Unit (2, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_003617K173NGSTM1_HUMANPolymorphism1065411A/B/C/D/E/FK172N
2UniProtVAR_014497S210TGSTM1_HUMANPolymorphism449856A/B/C/D/E/FS209T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_003617K173NGSTM1_HUMANPolymorphism1065411A/BK172N
2UniProtVAR_014497S210TGSTM1_HUMANPolymorphism449856A/BS209T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_003617K173NGSTM1_HUMANPolymorphism1065411C/DK172N
2UniProtVAR_014497S210TGSTM1_HUMANPolymorphism449856C/DS209T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_003617K173NGSTM1_HUMANPolymorphism1065411E/FK172N
2UniProtVAR_014497S210TGSTM1_HUMANPolymorphism449856E/FS209T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 11)

Asymmetric Unit (2, 11)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.GSTM1_HUMAN1-88
 
 
 
 
  5A:0-87
B:0-87
D:0-87
E:0-87
F:0-87
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTM1_HUMAN90-208
 
 
 
 
 
  6A:89-207
B:89-207
C:89-207
D:89-207
E:89-207
F:89-207
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.GSTM1_HUMAN1-88
 
 
 
 
  2A:0-87
B:0-87
-
-
-
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTM1_HUMAN90-208
 
 
 
 
 
  2A:89-207
B:89-207
-
-
-
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.GSTM1_HUMAN1-88
 
 
 
 
  1-
-
D:0-87
-
-
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTM1_HUMAN90-208
 
 
 
 
 
  2-
-
C:89-207
D:89-207
-
-
Biological Unit 3 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.GSTM1_HUMAN1-88
 
 
 
 
  2-
-
-
E:0-87
F:0-87
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTM1_HUMAN90-208
 
 
 
 
 
  2-
-
-
-
E:89-207
F:89-207

(-) Exons   (8, 48)

Asymmetric Unit (8, 48)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1eENST000003098511eENSE00001850517chr1:110230472-11023053160GSTM1_HUMAN1-12126A:0-11
B:0-11
C:1-11
D:0-11
E:0-11
F:0-11
12
12
11
12
12
12
1.2aENST000003098512aENSE00001753103chr1:110230792-11023086776GSTM1_HUMAN13-38266A:12-37
B:12-37
C:12-37
D:12-37
E:12-37
F:12-37
26
26
26
26
26
26
1.2dENST000003098512dENSE00001706290chr1:110231295-11023135965GSTM1_HUMAN38-59226A:37-58
B:37-58
C:37-58
D:37-58
E:37-58
F:37-58
22
22
22
22
22
22
1.2hENST000003098512hENSE00001631442chr1:110231670-11023175182GSTM1_HUMAN60-87286A:59-86
B:59-86
C:59-86
D:59-86
E:59-86
F:59-86
28
28
28
28
28
28
1.3ENST000003098513ENSE00000826761chr1:110231847-110231947101GSTM1_HUMAN87-120346A:86-119
B:86-119
C:86-119
D:86-119
E:86-119
F:86-119
34
34
34
34
34
34
1.4bENST000003098514bENSE00001715778chr1:110232893-11023298896GSTM1_HUMAN121-152326A:120-151
B:120-151
C:120-151
D:120-151
E:120-151
F:120-151
32
32
32
32
32
32
1.5aENST000003098515aENSE00001716973chr1:110233076-110233186111GSTM1_HUMAN153-189376A:152-188
B:152-188
C:152-188
D:152-188
E:152-188
F:152-188
37
37
37
37
37
37
1.7dENST000003098517dENSE00001825142chr1:110235828-110236367540GSTM1_HUMAN190-218296A:189-217
B:189-217
C:189-217
D:189-217
E:189-217
F:189-217
29
29
29
29
29
29

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:218
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        
          GSTM1_HUMAN     1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3ma2 A:0-84 Class mu GST                                                          d2f3ma1 A:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mA01 A:0-85,A:191-217 Glutaredoxin                                                 2f3mA02 A:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mA01 A:0-85,A:191-217    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh...eeeeee.........hhhhhhhhh..........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:0-87 UniProt: 1-88                                                     -GST_CTER  PDB: A:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e   Exon 1.2a  PDB: A:12-37   ---------------------Exon 1.2h  PDB: A:59-86     ---------------------------------Exon 1.4b  PDB: A:120-151       Exon 1.5a  PDB: A:152-188            Exon 1.7d  PDB: A:189-217     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2d  PDB: A:37-5---------------------------Exon 1.3  PDB: A:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m A   0 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209        

Chain B from PDB  Type:PROTEIN  Length:218
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        
          GSTM1_HUMAN     1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3mb2 B:0-84 Class mu GST                                                          d2f3mb1 B:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mB01 B:0-85,B:191-217 Glutaredoxin                                                 2f3mB02 B:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mB01 B:0-85,B:191-217    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh..eeeeee.........hhhhhh.............eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:0-87 UniProt: 1-88                                                     -GST_CTER  PDB: B:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e   Exon 1.2a  PDB: B:12-37   ---------------------Exon 1.2h  PDB: B:59-86     ---------------------------------Exon 1.4b  PDB: B:120-151       Exon 1.5a  PDB: B:152-188            Exon 1.7d  PDB: B:189-217     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2d  PDB: B:37-5---------------------------Exon 1.3  PDB: B:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m B   0 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209        

Chain C from PDB  Type:PROTEIN  Length:217
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM1_HUMAN     2 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3mc2 C:1-84 Class mu GST                                                         d2f3mc1 C:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mC01 C:1-85,C:191-217 Glutaredoxin                                                2f3mC02 C:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mC01 C:1-85,C:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhh...eeeeee.........hhhhhh.............eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: - UniProt: 1-88                                                         -GST_CTER  PDB: C:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e  Exon 1.2a  PDB: C:12-37   ---------------------Exon 1.2h  PDB: C:59-86     ---------------------------------Exon 1.4b  PDB: C:120-151       Exon 1.5a  PDB: C:152-188            Exon 1.7d  PDB: C:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: C:37-5---------------------------Exon 1.3  PDB: C:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m C   1 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       

Chain D from PDB  Type:PROTEIN  Length:218
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        
          GSTM1_HUMAN     1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3md2 D:0-84 Class mu GST                                                          d2f3md1 D:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mD01 D:0-85,D:191-217 Glutaredoxin                                                 2f3mD02 D:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mD01 D:0-85,D:191-217    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh...eeeeee.........hhhhhh.............eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: D:0-87 UniProt: 1-88                                                     -GST_CTER  PDB: D:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e   Exon 1.2a  PDB: D:12-37   ---------------------Exon 1.2h  PDB: D:59-86     ---------------------------------Exon 1.4b  PDB: D:120-151       Exon 1.5a  PDB: D:152-188            Exon 1.7d  PDB: D:189-217     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2d  PDB: D:37-5---------------------------Exon 1.3  PDB: D:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m D   0 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209        

Chain E from PDB  Type:PROTEIN  Length:218
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        
          GSTM1_HUMAN     1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3me2 E:0-84 Class mu GST                                                          d2f3me1 E:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mE01 E:0-85,E:191-217 Glutaredoxin                                                 2f3mE02 E:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mE01 E:0-85,E:191-217    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh...eeeeee.........hhhhhh.............eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: E:0-87 UniProt: 1-88                                                     -GST_CTER  PDB: E:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e   Exon 1.2a  PDB: E:12-37   ---------------------Exon 1.2h  PDB: E:59-86     ---------------------------------Exon 1.4b  PDB: E:120-151       Exon 1.5a  PDB: E:152-188            Exon 1.7d  PDB: E:189-217     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2d  PDB: E:37-5---------------------------Exon 1.3  PDB: E:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m E   0 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209        

Chain F from PDB  Type:PROTEIN  Length:218
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        
          GSTM1_HUMAN     1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d2f3mf2 F:0-84 Class mu GST                                                          d2f3mf1 F:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 2f3mF01 F:0-85,F:191-217 Glutaredoxin                                                 2f3mF02 F:86-190  [code=1.20.1050.10, no name defined]                                                   2f3mF01 F:0-85,F:191-217    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh...eeeeee.........hhhhhh.............eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: F:0-87 UniProt: 1-88                                                     -GST_CTER  PDB: F:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e   Exon 1.2a  PDB: F:12-37   ---------------------Exon 1.2h  PDB: F:59-86     ---------------------------------Exon 1.4b  PDB: F:120-151       Exon 1.5a  PDB: F:152-188            Exon 1.7d  PDB: F:189-217     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2d  PDB: F:37-5---------------------------Exon 1.3  PDB: F:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2f3m F   0 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 12)

Asymmetric Unit

(-) CATH Domains  (2, 12)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
1a2f3mA01A:0-85,A:191-217
1b2f3mB01B:0-85,B:191-217
1c2f3mD01D:0-85,D:191-217
1d2f3mE01E:0-85,E:191-217
1e2f3mF01F:0-85,F:191-217
1f2f3mC01C:1-85,C:191-217

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2F3M)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (GSTM1_HUMAN | P09488)
molecular function
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0043295    glutathione binding    Interacting selectively and non-covalently with glutathione; a tripeptide composed of the three amino acids cysteine, glutamic acid and glycine.
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0070458    cellular detoxification of nitrogen compound    Any cellular process that reduces or removes the toxicity of nitrogenous compounds which are dangerous or toxic. This includes the aerobic conversion of toxic compounds to harmless substances.
    GO:1901687    glutathione derivative biosynthetic process    The chemical reactions and pathways resulting in the formation of glutathione derivative.
    GO:0006749    glutathione metabolic process    The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0018916    nitrobenzene metabolic process    The chemical reactions and pathways involving nitrobenzene (nitrobenzol), a derivative of benzene with an NO2 group attached to the ring. It is a yellow aromatic liquid used in perfumery and manufactured in large quantities in the preparation of aniline.
    GO:0042178    xenobiotic catabolic process    The chemical reactions and pathways resulting in the breakdown of a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GTD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:37 - Pro A:38   [ RasMol ]  
    Ala B:37 - Pro B:38   [ RasMol ]  
    Ala C:37 - Pro C:38   [ RasMol ]  
    Ala D:37 - Pro D:38   [ RasMol ]  
    Ala E:37 - Pro E:38   [ RasMol ]  
    Ala F:37 - Pro F:38   [ RasMol ]  
    Arg A:205 - Pro A:206   [ RasMol ]  
    Arg B:205 - Pro B:206   [ RasMol ]  
    Arg C:205 - Pro C:206   [ RasMol ]  
    Arg D:205 - Pro D:206   [ RasMol ]  
    Arg E:205 - Pro E:206   [ RasMol ]  
    Arg F:205 - Pro F:206   [ RasMol ]  
    Leu A:59 - Pro A:60   [ RasMol ]  
    Leu B:59 - Pro B:60   [ RasMol ]  
    Leu C:59 - Pro C:60   [ RasMol ]  
    Leu D:59 - Pro D:60   [ RasMol ]  
    Leu E:59 - Pro E:60   [ RasMol ]  
    Leu F:59 - Pro F:60   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2f3m
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSTM1_HUMAN | P09488
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GSTM1_HUMAN | P09488
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSTM1_HUMAN | P094881gtu 1xw6 1xwk 1yj6

(-) Related Entries Specified in the PDB File

1gtu LIGAND-FREE GSTM1A-1A
1xw6 STRUCTURE OF HUMAN GLUTATHIONE S- TRANSFERASE M1A-1A COMPLEXED WITH GLUTATHIONE
1xwk STRUCTURE OF HUMAN GLUTATHIONE S-TRANSFERASE M1A-1A COMPLEXED WITH GLUTATHIONYL-S-DINITROBENZENE