Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE THIRD SUSHI DOMAIN FROM HUMAN CUB AND SUSHI DOMAIN-CONTAINING PROTEIN 1
 
Authors :  K. Inoue, T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  06 Mar 07  (Deposition) - 11 Sep 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sushi Domain, Cub And Sushi Domain-Containing Protein 1 Precursor, Cub And Sushi Multiple Domains Protein 1, Csmd1, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Inoue, T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of The Third Sushi Domain From Human Cub And Sushi Domain-Containing Protein 1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CUB AND SUSHI DOMAIN-CONTAINING PROTEIN 1
    ChainsA
    EngineeredYES
    Expression System PlasmidP060731-03
    Expression System Vector TypePLASMID
    FragmentSUSHI DOMAIN
    GeneCSMD1, KIAA1890
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymCUB AND SUSHI MULTIPLE DOMAINS PROTEIN 1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EHF)

(-) Sites  (0, 0)

(no "Site" information available for 2EHF)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:14 -A:54
2A:40 -A:67

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EHF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EHF)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CUBPS01180 CUB domain profile.CSMD1_HUMAN32-140
208-312
412-523
585-693
759-867
931-1041
1105-1213
1278-1387
1452-1560
1626-1734
1803-1911
1975-2083
2147-2258
2320-2431
  1-
-
-
A:71-73
-
-
-
-
-
-
-
-
-
-
2SUSHIPS50923 Sushi/CCP/SCR domain profile.CSMD1_HUMAN143-204
347-409
526-583
696-757
872-929
1044-1103
1216-1276
1390-1450
1563-1624
1740-1801
1914-1973
2086-2145
2257-2318
2431-2493
2494-2555
2556-2620
2621-2678
2679-2736
2737-2794
2795-2857
2858-2915
2919-2976
2977-3035
3036-3095
3096-3153
3154-3211
3215-3273
3274-3333
  1-
-
A:12-67
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 2EHF)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:73
 aligned with CSMD1_HUMAN | Q96PZ7 from UniProtKB/Swiss-Prot  Length:3565

    Alignment length:108
                                   496       506       516       526       536       546       556       566       576       586        
          CSMD1_HUMAN   487 GSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSG 594
               SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...----------------------....------................eee........eeeee...........eee...............-------..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE CUB  PDB: - UniProt: 412-523         --SUSHI  PDB: A:12-67 UniProt: 526-583                      -CUB        PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 2ehf A   1 GSS----------------------GSSG------EIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCS-------GPSSG  73
                              |      -         -     |  |-     |  12        22        32        42        52        62     |   -   |    
                              3                      4  7      8                                                          68      69    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2EHF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EHF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EHF)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (CSMD1_HUMAN | Q96PZ7)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ehf)
 
  Sites
(no "Sites" information available for 2ehf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ehf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ehf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSMD1_HUMAN | Q96PZ7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CSMD1_HUMAN | Q96PZ7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2EHF)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EHF)