Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE SH3 DOMAIN FROM HUMAN SAM AND SH3 DOMAIN CONTAINING PROTEIN 1
 
Authors :  H. P. Zhang, C. Kurosaki, M. Yoshida, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  09 Feb 07  (Deposition) - 14 Aug 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sh3 Domain, Sam And Sh3 Domain-Containing Protein 1, Proline-Glutamate Repeat-Containing Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. P. Zhang, C. Kurosaki, M. Yoshida, F. Hayashi, S. Yokoyama
Solution Structure Of The Sh3 Domain From Human Sam And Sh3 Domain Containing Protein 1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SAM AND SH3 DOMAIN-CONTAINING PROTEIN 1
    ChainsA
    EngineeredYES
    Expression System PlasmidP050719-13
    Expression System Vector TypePLASMID
    FragmentSH3 DOMAIN
    GeneSASH1, KIAA0790, PEPE1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL FREE PROTEIN SYNTHESIS
    SynonymPROLINE-GLUTAMATE REPEAT-CONTAINING PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EBP)

(-) Sites  (0, 0)

(no "Site" information available for 2EBP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EBP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EBP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EBP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2EBP)

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000003674672ENSE00001444575chr6:148663729-148664359631SASH1_HUMAN1-52520--
1.5ENST000003674675ENSE00001612635chr6:148711270-148711398129SASH1_HUMAN53-95430--
1.6ENST000003674676ENSE00001646510chr6:148761320-14876137051SASH1_HUMAN96-112170--
1.7aENST000003674677aENSE00002157931chr6:148761494-14876154350SASH1_HUMAN113-129170--
1.8aENST000003674678aENSE00001793219chr6:148789681-14878972141SASH1_HUMAN129-143150--
1.9ENST000003674679ENSE00001745948chr6:148792553-14879263987SASH1_HUMAN143-172300--
1.10ENST0000036746710ENSE00001599661chr6:148795246-148795358113SASH1_HUMAN172-209380--
1.11ENST0000036746711ENSE00000765054chr6:148808750-148808851102SASH1_HUMAN210-243340--
1.12ENST0000036746712ENSE00000765053chr6:148835460-148835592133SASH1_HUMAN244-288450--
1.13ENST0000036746713ENSE00000765052chr6:148840683-148841029347SASH1_HUMAN288-4031160--
1.14ENST0000036746714ENSE00000765051chr6:148846427-14884650175SASH1_HUMAN404-428250--
1.15ENST0000036746715ENSE00000765049chr6:148848589-148848732144SASH1_HUMAN429-476480--
1.16ENST0000036746716ENSE00000765048chr6:148852662-148852797136SASH1_HUMAN477-522461A:1-66
1.17ENST0000036746717ENSE00000765047chr6:148853933-148854102170SASH1_HUMAN522-578571A:6-31 (gaps)57
1.18ENST0000036746718ENSE00000765046chr6:148854907-148855116210SASH1_HUMAN579-648701A:32-73 (gaps)52
1.19ENST0000036746719ENSE00000765045chr6:148855887-148856037151SASH1_HUMAN649-699510--
1.20ENST0000036746720ENSE00000799100chr6:148861579-148861692114SASH1_HUMAN699-737390--
1.21ENST0000036746721ENSE00000799101chr6:148864816-1488659541139SASH1_HUMAN737-11163800--
1.22ENST0000036746722ENSE00000765041chr6:148867151-148867282132SASH1_HUMAN1117-1160440--
1.23ENST0000036746723ENSE00001444573chr6:148869431-1488731863756SASH1_HUMAN1161-1247870--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:73
 aligned with SASH1_HUMAN | O94885 from UniProtKB/Swiss-Prot  Length:1247

    Alignment length:114
                                   526       536       546       556       566       576       586       596       606       616       626    
          SASH1_HUMAN   517 GQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKG 630
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......-------------------------------..eeeee....................eeeeee......eeee....eeee....eee....------..----.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.16  --------------------------------------------------------Exon 1.18  PDB: A:32-73 (gaps) UniProt: 579-648      Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.17  PDB: A:6-31 (gaps) UniProt: 522-578           ---------------------------------------------------- Transcript 1 (2)
                 2ebp A   1 GSSGSSG-------------------------------FCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSSG------PS----SG  73
                                  |  -         -         -        |9        19        29        39        49        59        69      || -  | 
                                  7                               8                                                           69     70|   72 
                                                                                                                                      71      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2EBP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EBP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EBP)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)
Chain A   (SASH1_HUMAN | O94885)
molecular function
    GO:0031435    mitogen-activated protein kinase kinase kinase binding    Interacting selectively and non-covalently with a mitogen-activated protein kinase kinase kinase, any protein that can phosphorylate a MAP kinase kinase.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0032947    protein complex scaffold activity    A structural molecule activity that provides a physical support for the assembly of a multiprotein complex. The scaffold may or may not be part of the final complex.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0043507    positive regulation of JUN kinase activity    Any process that activates or increases the frequency, rate or extent of JUN kinase activity.
    GO:1901224    positive regulation of NIK/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of NIK/NF-kappaB signaling.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0010595    positive regulation of endothelial cell migration    Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
    GO:0031666    positive regulation of lipopolysaccharide-mediated signaling pathway    Any process that activates or increases the frequency, rate or extent of signaling in response to detection of lipopolysaccharide.
    GO:1900745    positive regulation of p38MAPK cascade    Any process that activates or increases the frequency, rate or extent of p38MAPK cascade.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:1900044    regulation of protein K63-linked ubiquitination    Any process that modulates the frequency, rate or extent of protein K63-linked ubiquitination.
    GO:1902498    regulation of protein autoubiquitination    Any process that modulates the frequency, rate or extent of protein autoubiquitination.
cellular component
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ebp)
 
  Sites
(no "Sites" information available for 2ebp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ebp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ebp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SASH1_HUMAN | O94885
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SASH1_HUMAN | O94885
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SASH1_HUMAN | O948852dl0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EBP)