Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE 14TH FILAMIN DOMAIN FROM HUMAN FILAMIN-B
 
Authors :  T. Tomizawa, S. Koshiba, S. Watanabe, T. Harada, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  25 Jan 07  (Deposition) - 31 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Beta-Sandwich, Immunoglobulin-Like Fold, Filamin, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Tomizawa, S. Koshiba, S. Watanabe, T. Harada, T. Kigawa, S. Yokoyama
Solution Structure Of The 14Th Filamin Domain From Human Filamin-B
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FILAMIN-B
    ChainsA
    EngineeredYES
    Expression System PlasmidP060619-05
    Expression System Vector TypePLASMID
    FragmentFILAMIN DOMAIN
    GeneFLNB
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymFLN-B, BETA-FILAMIN, ACTIN-BINDING-LIKE PROTEIN, THYROID AUTOANTIGEN, TRUNCATED ACTIN-BINDING PROTEIN, TRUNCATED ABP, ABP- 280 HOMOLOG, ABP-278, FILAMIN 3, FILAMIN HOMOLOG 1, FH1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2E9J)

(-) Sites  (0, 0)

(no "Site" information available for 2E9J)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2E9J)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Ser A:106 -Pro A:107

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 5)

NMR Structure (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035920A1534GFLNB_HUMANUnclassified  ---AA38G
2CancerSNPVAR_FLNB_HUMAN_CCDS2885_1_04 *A1534GFLNB_HUMANDisease (Breast cancer)  ---AA38G
3UniProtVAR_033083G1586RFLNB_HUMANDisease (LRS)28939706AG90R
4UniProtVAR_033084V1592DFLNB_HUMANDisease (LRS)80356514AV96D
5UniProtVAR_033085P1603LFLNB_HUMANDisease (LRS)80356515AP107L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FILAMIN_REPEATPS50194 Filamin/ABP280 repeat profile.FLNB_HUMAN249-347
349-446
447-543
544-636
640-736
737-839
840-938
939-1034
1035-1127
1128-1222
1223-1322
1323-1415
1416-1511
1512-1608
1609-1704
1709-1816
1816-1908
1919-1994
1997-2089
2087-2185
2188-2280
2282-2375
2379-2471
2507-2601
  2-
-
-
-
-
-
-
-
-
-
-
-
-
A:16-112
A:113-119
-
-
-
-
-
-
-
-
-

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002959561ENSE00001415463chr3:57994127-57994583457FLNB_HUMAN1-98980--
1.2ENST000002959562ENSE00001298400chr3:58062773-58063021249FLNB_HUMAN98-181840--
1.4ENST000002959564ENSE00001315475chr3:58064444-5806454198FLNB_HUMAN181-213330--
1.5ENST000002959565ENSE00001299267chr3:58067356-58067503148FLNB_HUMAN214-263500--
1.6ENST000002959566ENSE00001661279chr3:58080563-58080681119FLNB_HUMAN263-302400--
1.7ENST000002959567ENSE00001295579chr3:58081868-5808194578FLNB_HUMAN303-328260--
1.8ENST000002959568ENSE00001312484chr3:58083542-58083704163FLNB_HUMAN329-383550--
1.9ENST000002959569ENSE00001316025chr3:58084438-58084635198FLNB_HUMAN383-449670--
1.10ENST0000029595610ENSE00001295364chr3:58087930-58088067138FLNB_HUMAN449-495470--
1.11ENST0000029595611ENSE00001180356chr3:58089686-58089812127FLNB_HUMAN495-537430--
1.12ENST0000029595612ENSE00001296552chr3:58090807-58090943137FLNB_HUMAN537-583470--
1.13ENST0000029595613ENSE00001313345chr3:58092407-58092600194FLNB_HUMAN583-647650--
1.14ENST0000029595614ENSE00001180347chr3:58094185-58094298114FLNB_HUMAN648-685380--
1.15ENST0000029595615ENSE00001180346chr3:58094906-58095049144FLNB_HUMAN686-733480--
1.16ENST0000029595616ENSE00001180344chr3:58095303-58095426124FLNB_HUMAN734-775420--
1.17ENST0000029595617ENSE00001180363chr3:58095737-58095897161FLNB_HUMAN775-828540--
1.18ENST0000029595618ENSE00001212915chr3:58097518-5809760891FLNB_HUMAN829-859310--
1.19ENST0000029595619ENSE00001212911chr3:58097876-58098045170FLNB_HUMAN859-915570--
1.20ENST0000029595620ENSE00001180403chr3:58104599-58104716118FLNB_HUMAN916-955400--
1.21ENST0000029595621ENSE00001077282chr3:58106968-58107230263FLNB_HUMAN955-1042880--
1.22ENST0000029595622ENSE00001077198chr3:58108820-58109417598FLNB_HUMAN1043-12422000--
1.23ENST0000029595623ENSE00001180390chr3:58110059-58110232174FLNB_HUMAN1242-1300590--
1.24ENST0000029595624ENSE00001077200chr3:58111308-58111470163FLNB_HUMAN1300-1354550--
1.25ENST0000029595625ENSE00000861937chr3:58112329-58112489161FLNB_HUMAN1354-1408550--
1.26ENST0000029595626ENSE00001328202chr3:58116468-58116635168FLNB_HUMAN1408-1464571A:1-7 (gaps)20
1.28bENST0000029595628bENSE00001306228chr3:58118535-58118658124FLNB_HUMAN1464-1505421A:8-92
1.29ENST0000029595629ENSE00000861956chr3:58120343-58120499157FLNB_HUMAN1505-1557531A:9-6153
1.30ENST0000029595630ENSE00001306477chr3:58121706-58121895190FLNB_HUMAN1558-1621641A:62-11958
1.31ENST0000029595631ENSE00001077270chr3:58124009-58124256248FLNB_HUMAN1621-1703830--
1.32bENST0000029595632bENSE00001302065chr3:58127585-5812765672FLNB_HUMAN1704-1727240--
1.33ENST0000029595633ENSE00001077215chr3:58128377-58128479103FLNB_HUMAN1728-1762350--
1.34ENST0000029595634ENSE00000861939chr3:58129200-58129340141FLNB_HUMAN1762-1809480--
1.35ENST0000029595635ENSE00001321882chr3:58131648-58131776129FLNB_HUMAN1809-1852440--
1.36bENST0000029595636bENSE00001794478chr3:58132547-58132720174FLNB_HUMAN1852-1910590--
1.37ENST0000029595637ENSE00001077251chr3:58133933-58134091159FLNB_HUMAN1910-1963540--
1.38ENST0000029595638ENSE00001077284chr3:58134376-58134579204FLNB_HUMAN1963-2031690--
1.39bENST0000029595639bENSE00001299342chr3:58135577-58135729153FLNB_HUMAN2031-2082520--
1.40aENST0000029595640aENSE00001077210chr3:58135832-58135954123FLNB_HUMAN2082-2123420--
1.42bENST0000029595642bENSE00002184457chr3:58139102-58139368267FLNB_HUMAN2123-2212900--
1.43bENST0000029595643bENSE00001690887chr3:58140518-58140655138FLNB_HUMAN2212-2258470--
1.44aENST0000029595644aENSE00001770288chr3:58141687-58141802116FLNB_HUMAN2258-2296390--
1.45aENST0000029595645aENSE00001794279chr3:58145281-58145413133FLNB_HUMAN2297-2341450--
1.46aENST0000029595646aENSE00001646117chr3:58148881-58149057177FLNB_HUMAN2341-2400600--
1.48aENST0000029595648aENSE00001767941chr3:58154167-58154385219FLNB_HUMAN2400-2473740--
1.48cENST0000029595648cENSE00001616994chr3:58155317-58155520204FLNB_HUMAN2473-2541690--
1.49dENST0000029595649dENSE00001627815chr3:58156302-581579781677FLNB_HUMAN2541-2602620--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:119
 aligned with FLNB_HUMAN | O75369 from UniProtKB/Swiss-Prot  Length:2602

    Alignment length:184
                                  1441      1451      1461      1471      1481      1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591      1601      1611    
          FLNB_HUMAN   1432 GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDAS 1615
               SCOP domains d2             e9ja_                                                     A: Filamin b                                                                                                    SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..-------------.....----------------------------------------------------............hhh.eeeehhhhh...ee....eeeeeee.......ee..ee........eeeee....eeeeee......eeee..ee.........eeeeee...... Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------------------------------------------------------------G---------------------------------------------------R-----D----------L------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE FILAMIN_REPEAT  PDB: - UniProt: 1416-1511                                       FILAMIN_REPEAT  PDB: A:16-112 UniProt: 1512-1608                                                 FILAMIN PROSITE
           Transcript 1 (1) Exon 1.26  PDB: A:1-7 (gaps)     ----------------------------------------Exon 1.29  PDB: A:9-61 UniProt: 1505-1557            Exon 1.30  PDB: A:62-119 UniProt: 1558-1621 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.28b  PDB: A:8-9 UniProt: 1464-1505 -------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                2e9j A    1 GS-------------SGSSG----------------------------------------------------RSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDAS  119
                             |       -     |   7         -         -         -         -         -  |     15        25        35        45        55        65        75        85        95       105       115    
                             2             3   7                                                    8                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2E9J)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2E9J)

(-) Gene Ontology  (24, 24)

NMR Structure(hide GO term definitions)
Chain A   (FLNB_HUMAN | O75369)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030036    actin cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0007016    cytoskeletal anchoring at plasma membrane    A cytoskeleton organization process that directly or indirectly links cytoskeletal filaments to the plasma membrane.
    GO:0003382    epithelial cell morphogenesis    The change in form that occurs when an epithelial cell progresses from its initial formation to its mature state.
    GO:0003334    keratinocyte development    The process whose specific outcome is the progression of a keratinocyte over time, from its formation to the mature structure.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0007517    muscle organ development    The process whose specific outcome is the progression of the muscle over time, from its formation to the mature structure. The muscle is an organ consisting of a tissue made up of various elongated cells that are specialized to contract and thus to produce movement and mechanical work.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007519    skeletal muscle tissue development    The developmental sequence of events leading to the formation of adult skeletal muscle tissue. The main events are: the fusion of myoblasts to form myotubes that increase in size by further fusion to them of myoblasts, the formation of myofibrils within their cytoplasm and the establishment of functional neuromuscular junctions with motor neurons. At this stage they can be regarded as mature muscle fibers.
cellular component
    GO:0030018    Z disc    Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0005903    brush border    The dense covering of microvilli on the apical surface of a epithelial cells in tissues such as the intestine, kidney, and choroid plexus; the microvilli aid absorption by increasing the surface area of the cell.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0001725    stress fiber    A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2e9j)
 
  Sites
(no "Sites" information available for 2e9j)
 
  Cis Peptide Bonds
    Ser A:106 - Pro A:107   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2e9j
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FLNB_HUMAN | O75369
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  150250
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FLNB_HUMAN | O75369
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FLNB_HUMAN | O753692di8 2di9 2dia 2dib 2dic 2dj4 2dlg 2dmb 2dmc 2e9i 2ee6 2ee9 2eea 2eeb 2eec 2eed 2wa5 2wa6 2wa7 3fer 4b7l 5dcp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2E9J)