Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RSGI RUH-048, A GTF2I DOMAIN IN HUMAN CDNA
 
Authors :  Y. Doi-Katayama, H. Hirota, N. Tochio, S. Koshiba, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  09 Dec 05  (Deposition) - 09 Jun 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Transcription Factor, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Doi-Katayama, H. Hirota, N. Tochio, S. Koshiba, T. Kigawa, S. Yokoyama
Solution Structure Of Rsgi Ruh-048, A Gtf2I Domain In Human Cdna
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GENERAL TRANSCRIPTION FACTOR II-I REPEAT DOMAIN- CONTAINING PROTEIN 1
    ChainsA
    EngineeredYES
    Expression System PlasmidP050131-11
    Expression System Vector TypePLASMID
    FragmentGTF2I DOMAIN
    GeneNP005676
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS(E. COLI)
    SynonymGTF2I REPEAT DOMAIN CONTAINING PROTEIN 1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2D99)

(-) Sites  (0, 0)

(no "Site" information available for 2D99)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2D99)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2D99)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2D99)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GTF2IPS51139 GTF2I-like repeat profile.GT2D1_HUMAN119-213
342-436
556-650
696-790
793-887
  1A:7-82
-
-
-
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002657551aENSE00001341217chr7:73868120-73868506387GT2D1_HUMAN-00--
1.3ENST000002657553ENSE00002196204chr7:73922405-73922533129GT2D1_HUMAN1-41410--
1.4ENST000002657554ENSE00000691482chr7:73927160-73927301142GT2D1_HUMAN42-89480--
1.5bENST000002657555bENSE00000691481chr7:73929771-73929926156GT2D1_HUMAN89-141531A:1-21 (gaps)35
1.6ENST000002657556ENSE00000403997chr7:73932469-73932652184GT2D1_HUMAN141-202621A:21-8262
1.7ENST000002657557ENSE00000691478chr7:73933739-73934049311GT2D1_HUMAN202-3061051A:82-90 (gaps)51
1.8ENST000002657558ENSE00000403999chr7:73935538-7393562790GT2D1_HUMAN306-336310--
1.9ENST000002657559ENSE00000404000chr7:73938401-7393848484GT2D1_HUMAN336-364290--
1.10ENST0000026575510ENSE00000404001chr7:73944064-73944247184GT2D1_HUMAN364-425620--
1.11ENST0000026575511ENSE00001039150chr7:73949443-7394946826GT2D1_HUMAN425-434100--
1.12ENST0000026575512ENSE00000843247chr7:73950497-73950605109GT2D1_HUMAN434-470370--
1.13ENST0000026575513ENSE00001735710chr7:73952466-7395250338GT2D1_HUMAN470-483140--
1.14ENST0000026575514ENSE00000691417chr7:73953010-7395309081GT2D1_HUMAN483-510280--
1.15ENST0000026575515ENSE00001713711chr7:73954209-7395429890GT2D1_HUMAN510-540310--
1.16ENST0000026575516ENSE00001704452chr7:73959085-7395913248GT2D1_HUMAN540-556170--
1.17aENST0000026575517aENSE00001603168chr7:73960074-7396013966GT2D1_HUMAN556-578230--
1.18ENST0000026575518ENSE00001801491chr7:73961433-73961616184GT2D1_HUMAN578-639620--
1.19ENST0000026575519ENSE00001716575chr7:73969504-7396955350GT2D1_HUMAN639-656180--
1.20aENST0000026575520aENSE00001147974chr7:73969723-73969824102GT2D1_HUMAN656-690350--
1.21ENST0000026575521ENSE00000691369chr7:73971969-7397205284GT2D1_HUMAN690-718290--
1.22ENST0000026575522ENSE00000691365chr7:73973191-73973374184GT2D1_HUMAN718-779620--
1.23aENST0000026575523aENSE00001039134chr7:73973957-7397398529GT2D1_HUMAN779-789110--
1.24ENST0000026575524ENSE00001147952chr7:74004180-7400425778GT2D1_HUMAN789-815270--
1.25ENST0000026575525ENSE00000404019chr7:74005154-74005346193GT2D1_HUMAN815-879650--
1.26ENST0000026575526ENSE00001039136chr7:74009341-7400937838GT2D1_HUMAN879-892140--
1.27cENST0000026575527cENSE00000691312chr7:74015371-74015507137GT2D1_HUMAN892-937460--
1.27fENST0000026575527fENSE00001882339chr7:74016692-74016917226GT2D1_HUMAN938-959220--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:90
 aligned with GT2D1_HUMAN | Q9UHL9 from UniProtKB/Swiss-Prot  Length:959

    Alignment length:146
                                   116       126       136       146       156       166       176       186       196       206       216       226       236       246      
          GT2D1_HUMAN   107 GEGGGRSLPRSSLEHGSDVYLLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKLKRPLEDGGRDSKALVELNGVSLIPKGSRDCGLHGQAPKVPPQDLPPTATSSS 252
               SCOP domains d2d9      9a   _      A: automated matches                                                                                                         SCOP domains
               CATH domains 2d99      A0   0      A:1-90 GTF2I-like repeat                                                                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....------..---.-----hhhhhhhhhhhhhhhh..........hhhhhh....eeee...............hhhhhhhhhh....eeee..------------------------------------------........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------GTF2I  PDB: A:7-82 UniProt: 119-213                                                            --------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: A:1-21 (gaps)      ------------------------------------------------------------Exon 1.7  PDB: A:82-90 (gaps) UniProt: 202-306      Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.6  PDB: A:21-82 UniProt: 141-202                       -------------------------------------------------- Transcript 1 (2)
                 2d99 A   1 GSSG------SS---G-----LRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKLKR------------------------------------------PSSGPSSG  90
                               |     -||   |   - |      16        26        36        46        56        66        76     |   -         -         -         -        84      
                               4      5|   7     8                                                                        82                                         83       
                                       6                                                                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2D99)

(-) Gene Ontology  (12, 12)

NMR Structure(hide GO term definitions)
Chain A   (GT2D1_HUMAN | Q9UHL9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000981    RNA polymerase II transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0003705    transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to modulate transcription by RNAP II.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0014886    transition between slow and fast fiber    The process of conversion of slow-contracting muscle fibers to a faster character. This may involve increasing of contractile rate, fast myosin gene induction, increase in glycolytic metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2d99)
 
  Sites
(no "Sites" information available for 2d99)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d99)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2d99
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GT2D1_HUMAN | Q9UHL9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GT2D1_HUMAN | Q9UHL9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GT2D1_HUMAN | Q9UHL92dn5 2dzq 2dzr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2D99)