Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF TANDEM REPEAT OF THE FIFTH AND SIXTH ZINC-FINGER C2HC DOMAINS FROM HUMAN ST18
 
Authors :  T. Suetake, T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  20 May 05  (Deposition) - 20 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  St18, Zinc-Finger, C2Hc, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Suetake, T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of Tandem Repeat Of The Fifth And Sixth Zinc-Finger C2Hc Domains From Human St18
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KIAA0535 PROTEIN
    ChainsA
    EngineeredYES
    Expression System PlasmidP040921-02
    Expression System Vector TypePLASMID
    FragmentTHE FIFTH AND SIXTH C2HC DOMAINS
    GeneKAZUSA CDNA HG03847
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL FREE PROTEIN SYNTHESIS
    SynonymST18, SUPPRESSION OF TUMORIGENICITY 18, BREAST CARCINOMA, ZINC-FINGER PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

NMR Structure (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION

(-) Sites  (2, 2)

NMR Structure (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:12 , CYS A:17 , HIS A:30 , CYS A:36BINDING SITE FOR RESIDUE ZN A 401
2AC2SOFTWARECYS A:65 , CYS A:70 , HIS A:83 , CYS A:89BINDING SITE FOR RESIDUE ZN A 601

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CS8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CS8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CS8)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_CCHHCPS51802 Zinc finger CCHHC-type profile.ST18_HUMAN359-402
403-446
715-758
759-802
807-850
860-903
  2-
-
-
-
A:8-46
A:56-99

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2iENST000002764802iENSE00002137184chr8:53322303-5332224262ST18_HUMAN-00--
1.2jENST000002764802jENSE00001294032chr8:53322012-53321888125ST18_HUMAN-00--
1.10aENST0000027648010aENSE00001251017chr8:53142637-5314259246ST18_HUMAN-00--
1.11bENST0000027648011bENSE00001251007chr8:53134353-53134200154ST18_HUMAN-00--
1.12aENST0000027648012aENSE00001251003chr8:53133408-53133301108ST18_HUMAN-00--
1.13cENST0000027648013cENSE00001019604chr8:53130461-53130306156ST18_HUMAN-00--
1.14aENST0000027648014aENSE00001019606chr8:53126850-5312676388ST18_HUMAN1-19190--
1.15ENST0000027648015ENSE00001019605chr8:53124669-5312463931ST18_HUMAN19-29110--
1.19cENST0000027648019cENSE00000980342chr8:53092872-53092682191ST18_HUMAN29-93650--
1.20bENST0000027648020bENSE00000980343chr8:53085143-53084352792ST18_HUMAN93-3572650--
1.22ENST0000027648022ENSE00000980345chr8:53079546-53079412135ST18_HUMAN357-402460--
1.23ENST0000027648023ENSE00001717268chr8:53077785-5307769591ST18_HUMAN402-432310--
1.24ENST0000027648024ENSE00000980348chr8:53076650-53076546105ST18_HUMAN432-467360--
1.25ENST0000027648025ENSE00000980349chr8:53074128-53073935194ST18_HUMAN467-532660--
1.26ENST0000027648026ENSE00000980350chr8:53071669-53071458212ST18_HUMAN532-602710--
1.27bENST0000027648027bENSE00000980351chr8:53062537-53062292246ST18_HUMAN603-684820--
1.28ENST0000027648028ENSE00000980352chr8:53055605-53055490116ST18_HUMAN685-723390--
1.29bENST0000027648029bENSE00000980353chr8:53050043-5304998163ST18_HUMAN723-744220--
1.30ENST0000027648030ENSE00000980354chr8:53049218-5304915069ST18_HUMAN744-767240--
1.31ENST0000027648031ENSE00000980355chr8:53045861-5304579963ST18_HUMAN767-788221A:1-7 (gaps)10
1.32dENST0000027648032dENSE00000980356chr8:53045697-5304561781ST18_HUMAN788-815281A:8-114
1.33ENST0000027648033ENSE00001154984chr8:53044739-53044518222ST18_HUMAN815-889751A:11-8575
1.34aENST0000027648034aENSE00001151122chr8:53038700-5303861289ST18_HUMAN889-919311A:85-108 (gaps)30
1.35ENST0000027648035ENSE00001383173chr8:53031001-53030898104ST18_HUMAN919-953350--
1.36aENST0000027648036aENSE00001379726chr8:53028978-53028835144ST18_HUMAN954-1001480--
1.37cENST0000027648037cENSE00001373329chr8:53025898-530233992500ST18_HUMAN1002-1047460--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with ST18_HUMAN | O60284 from UniProtKB/Swiss-Prot  Length:1047

    Alignment length:147
                                   781       791       801       811       821       831       841       851       861       871       881       891       901       911       
           ST18_HUMAN   772 GCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGCPLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVIKKGKVSEELMTIKLKATG 918
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....---..------------------------------............................hhhhhhhhh............................................hhhhhhhh........------.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ZF_CCHHC  PDB: -               ----ZF_CCHHC  PDB: A:8-46 UniProt: 807-850      ---------ZF_CCHHC  PDB: A:56-99 UniProt: 860-903     --------------- PROSITE
           Transcript 1 (1) Exon 1.31        --------------------------Exon 1.33  PDB: A:11-85 UniProt: 815-889                                   ----------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.32d  PDB: A:8-11     -------------------------------------------------------------------------Exon 1.34a UniProt: 889-919    Transcript 1 (2)
                 2cs8 A   1 GSSGS---SG------------------------------PELKCPVIGCDGQGHISGKYTSHRTASGCPLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVIKKGKVSSG------PSSG 108
                                |   |7         -         -         -|       17        27        37        47        57        67        77        87        97      |  -   |   
                                5   6|                              8                                                                                             104    105   
                                     7                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2CS8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CS8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CS8)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (ST18_HUMAN | O60284)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cs8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cs8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ST18_HUMAN | O60284
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ST18_HUMAN | O60284
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CS8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CS8)