Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE UBA DOMAIN OF HUMAN UBASH3A PROTEIN
 
Authors :  K. Izumi, F. Hayashi, M. Yoshida, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  20 May 05  (Deposition) - 20 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Compact Three-Helix Bundle, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Izumi, F. Hayashi, M. Yoshida, S. Yokoyama
Solution Structure Of The Uba Domain Of Human Ubash3A Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UBASH3A PROTEIN
    ChainsA
    EngineeredYES
    Expression System PlasmidP040531-06
    Expression System Vector TypePLASMID
    FragmentUBA
    GeneUBASH3A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL FREE PROTEIN SYNTHESIS

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CRN)

(-) Sites  (0, 0)

(no "Site" information available for 2CRN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CRN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CRN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

NMR Structure (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_026971S18GUBS3A_HUMANPolymorphism2277798AS6G
2UniProtVAR_026972L28FUBS3A_HUMANPolymorphism2277800AL16F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBAPS50030 Ubiquitin-associated domain (UBA) profile.UBS3A_HUMAN15-60  1A:6-48

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003192941cENSE00001884887chr21:43824024-43824167144UBS3A_HUMAN1-38381A:1-26 (gaps)38
1.2ENST000003192942ENSE00001050394chr21:43826417-4382647054UBS3A_HUMAN38-56191A:26-4419
1.3ENST000003192943ENSE00001050385chr21:43829531-43829717187UBS3A_HUMAN56-118631A:44-62 (gaps)29
1.5ENST000003192945ENSE00001050391chr21:43833133-43833331199UBS3A_HUMAN119-185671A:63-642
1.6ENST000003192946ENSE00001050389chr21:43833519-43833632114UBS3A_HUMAN185-223390--
1.7ENST000003192947ENSE00001050401chr21:43836551-43836720170UBS3A_HUMAN223-279570--
1.8ENST000003192948ENSE00001050380chr21:43838510-43838718209UBS3A_HUMAN280-349700--
1.9ENST000003192949ENSE00001050397chr21:43846806-43846929124UBS3A_HUMAN349-390420--
1.10ENST0000031929410ENSE00001050392chr21:43852212-43852311100UBS3A_HUMAN391-424340--
1.11aENST0000031929411aENSE00001259628chr21:43854942-43855064123UBS3A_HUMAN424-465420--
1.12aENST0000031929412aENSE00001050381chr21:43857598-4385769093UBS3A_HUMAN465-496320--
1.13ENST0000031929413ENSE00001259529chr21:43862562-43862706145UBS3A_HUMAN496-544490--
1.14ENST0000031929414ENSE00001259523chr21:43863422-43863528107UBS3A_HUMAN544-580370--
1.15ENST0000031929415ENSE00001050377chr21:43864644-43864753110UBS3A_HUMAN580-616370--
1.16cENST0000031929416cENSE00001259600chr21:43867167-43867791625UBS3A_HUMAN617-661450--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:64
 aligned with UBS3A_HUMAN | P57075 from UniProtKB/Swiss-Prot  Length:661

    Alignment length:163
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160   
          UBS3A_HUMAN     1 MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSG 163
               SCOP domains -------------------d2crna1 A:8-58                                     --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....------------......hhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhh.........----------....-----------------------------------------------------------------------------.. Sec.struct. author
                 SAPs(SNPs) -----------------G---------F--------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------UBA  PDB: A:6-48 UniProt: 15-60               ------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c  PDB: A:1-26 (gaps)         -----------------Exon 1.3  PDB: A:44-62 (gaps) UniProt: 56-118 [INCOMPLETE]     Exon 1.5  PDB: A:63-64 UniProt: 119-185       Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2           ----------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2crn A   1 GSSGS------------SGSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPI----------SGPS-----------------------------------------------------------------------------SG  64
                                |    -       | 8        18        28        38        48        58         -|  |     -         -         -         -         -         -         -         - | 
                                5            6                                                  58         59 62                                                                            63 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CRN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CRN)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (UBS3A_HUMAN | P57075)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0050860    negative regulation of T cell receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0001817    regulation of cytokine production    Any process that modulates the frequency, rate, or extent of production of a cytokine.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2crn)
 
  Sites
(no "Sites" information available for 2crn)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2crn)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2crn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UBS3A_HUMAN | P57075
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  UBS3A_HUMAN | P57075
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CRN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CRN)