Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN BTLA-HVEM COMPLEX
 
Authors :  D. M. Compaan, L. C. Gonzalez, I. Tom, K. M. Loyet, D. Eaton, S. G. Hymowit
Date :  31 Aug 05  (Deposition) - 27 Sep 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,X,Y
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  X,Y  (1x)
Biol. Unit 3:  A (1x),B (1x),X (1x),Y (1x)
Keywords :  Igi Domain, Igg Domain, Tnfrsf, Protein-Protein Complex, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. M. Compaan, L. C. Gonzalez, I. Tom, K. M. Loyet, D. Eaton, S. G. Hymowitz
Attenuating Lymphocyte Activity: The Crystal Structure Of The Btla-Hvem Complex
J. Biol. Chem. V. 280 39553 2005
PubMed-ID: 16169851  |  Reference-DOI: 10.1074/JBC.M507629200

(-) Compounds

Molecule 1 - B AND T LYMPHOCYTE ATTENUATOR
    ChainsA, X
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPSTII.TIR3
    Expression System Strain33D3
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN (RESIDUES 26-137)
    GeneBTLA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymB AND T LYMPHOCYTE-ASSOCIATED PROTEIN
 
Molecule 2 - TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 14
    ChainsB, Y
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidPACGP67-B
    Expression System StrainHI5
    Expression System Taxid7108
    Expression System Vector TypePLASMID
    FragmentTRUNCATED EXTRACELLULAR DOMAIN CONTAINS CRD1, 2 AND PART OF CRD3 (RESIDUES 39-142)
    GeneTNFRSF14, HVEA, HVEM
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymHERPESVIRUS ENTRY MEDIATOR A, TUMOR NECROSIS FACTOR RECEPTOR-LIKE 2, TR2

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABXY
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  XY
Biological Unit 3 (1x)A (1x)B (1x)X (1x)Y (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric Unit (3, 5)
No.NameCountTypeFull Name
1FUL1Ligand/IonBETA-L-FUCOSE
2NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
3NI1Ligand/IonNICKEL (II) ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FUL-1Ligand/IonBETA-L-FUCOSE
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3NI-1Ligand/IonNICKEL (II) ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1FUL1Ligand/IonBETA-L-FUCOSE
2NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
3NI-1Ligand/IonNICKEL (II) ION
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1FUL-1Ligand/IonBETA-L-FUCOSE
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3NI-1Ligand/IonNICKEL (II) ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER B:70 , ASN B:72 , NAG B:202BINDING SITE FOR RESIDUE NAG B 201
2AC2SOFTWARENAG B:201BINDING SITE FOR RESIDUE NAG B 202
3AC3SOFTWAREARG Y:68 , ASN Y:72 , FUL Y:202BINDING SITE FOR RESIDUE NAG Y 201
4AC4SOFTWARENAG Y:201BINDING SITE FOR RESIDUE FUL Y 202
5AC5SOFTWAREHIS A:139 , HIS A:141BINDING SITE FOR RESIDUE NI A 1

(-) SS Bonds  (22, 22)

Asymmetric Unit
No.Residues
1A:34 -A:63
2A:58 -A:115
3A:72 -A:79
4B:4 -B:15
5B:16 -B:29
6B:19 -B:37
7B:40 -B:55
8B:58 -B:73
9B:61 -B:81
10B:83 -B:100
11B:89 -B:97
12X:34 -X:63
13X:58 -X:115
14X:72 -X:79
15Y:4 -Y:15
16Y:16 -Y:29
17Y:19 -Y:37
18Y:40 -Y:55
19Y:58 -Y:73
20Y:61 -Y:81
21Y:83 -Y:100
22Y:89 -Y:97

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu A:103 -Pro A:104
2Glu X:103 -Pro X:104

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_018955A117TTNR14_HUMANPolymorphism2234163B/YA79T
2UniProtVAR_056027I124VBTLA_HUMANPolymorphism16859633A/XI124V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_018955A117TTNR14_HUMANPolymorphism2234163BA79T
2UniProtVAR_056027I124VBTLA_HUMANPolymorphism16859633AI124V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_018955A117TTNR14_HUMANPolymorphism2234163YA79T
2UniProtVAR_056027I124VBTLA_HUMANPolymorphism16859633XI124V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_018955A117TTNR14_HUMANPolymorphism2234163B/YA79T
2UniProtVAR_056027I124VBTLA_HUMANPolymorphism16859633A/XI124V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNFR_NGFR_2PS50050 TNFR/NGFR family cysteine-rich region domain profile.TNR14_HUMAN41-75
 
77-119
 
  4B:3-37
Y:3-37
B:39-81
Y:39-81
2TNFR_NGFR_1PS00652 TNFR/NGFR family cysteine-rich region signature.TNR14_HUMAN78-119
 
  2B:40-81
Y:40-81
Biological Unit 1 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNFR_NGFR_2PS50050 TNFR/NGFR family cysteine-rich region domain profile.TNR14_HUMAN41-75
 
77-119
 
  2B:3-37
-
B:39-81
-
2TNFR_NGFR_1PS00652 TNFR/NGFR family cysteine-rich region signature.TNR14_HUMAN78-119
 
  1B:40-81
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNFR_NGFR_2PS50050 TNFR/NGFR family cysteine-rich region domain profile.TNR14_HUMAN41-75
 
77-119
 
  2-
Y:3-37
-
Y:39-81
2TNFR_NGFR_1PS00652 TNFR/NGFR family cysteine-rich region signature.TNR14_HUMAN78-119
 
  1-
Y:40-81
Biological Unit 3 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNFR_NGFR_2PS50050 TNFR/NGFR family cysteine-rich region domain profile.TNR14_HUMAN41-75
 
77-119
 
  4B:3-37
Y:3-37
B:39-81
Y:39-81
2TNFR_NGFR_1PS00652 TNFR/NGFR family cysteine-rich region signature.TNR14_HUMAN78-119
 
  2B:40-81
Y:40-81

(-) Exons   (6, 11)

Asymmetric Unit (6, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003345291aENSE00001336472chr3:112218408-112218118291BTLA_HUMAN1-30300--
1.2ENST000003345292ENSE00001336463chr3:112198616-112198302315BTLA_HUMAN30-1351062A:34-135
X:34-135
102
102
1.3ENST000003345293ENSE00001336459chr3:112190202-112190059144BTLA_HUMAN135-183492A:135-140 (gaps)
X:135-140
49
6
1.5aENST000003345295aENSE00001336457chr3:112188651-11218860547BTLA_HUMAN183-198161A:140-143
-
4
-
1.6cENST000003345296cENSE00001336466chr3:112185230-1121828152416BTLA_HUMAN199-289910--

2.3aENST000003557163aENSE00001409963chr1:2487805-2488172368TNR14_HUMAN1-23230--
2.4bENST000003557164bENSE00001035641chr1:2489165-2489273109TNR14_HUMAN24-60372B:2-22
Y:2-22
21
21
2.5aENST000003557165aENSE00001734381chr1:2489782-2489907126TNR14_HUMAN60-102432B:22-64
Y:22-64
43
43
2.5jENST000003557165jENSE00001345049chr1:2491262-2491417156TNR14_HUMAN102-154532B:64-103 (gaps)
Y:64-103 (gaps)
40
40
2.6bENST000003557166bENSE00002186068chr1:2492063-249215391TNR14_HUMAN154-184310--
2.6iENST000003557166iENSE00002149536chr1:2493112-2493254143TNR14_HUMAN184-232490--
2.6lENST000003557166lENSE00001035623chr1:2494304-249433532TNR14_HUMAN232-242110--
2.6pENST000003557166pENSE00001922328chr1:2494587-2495268682TNR14_HUMAN243-283410--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:110
 aligned with BTLA_HUMAN | Q7Z6A9 from UniProtKB/Swiss-Prot  Length:289

    Alignment length:153
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183   
           BTLA_HUMAN    34 CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQN 186
               SCOP domains d2aw2a1 A:34-137 B- and T-lymphocyte attenuator CD272                                                   ------------------------------------------------- SCOP domains
               CATH domains 2aw2A00 A:34-143 Immunoglobulins                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....eeeeee....eeeeeeee......eeeeeee....eee.....eeeee....eeeeeee...hhhhheeeeeeeee..eeee...eeeeeehhh-------------------------------------------hh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:34-135 UniProt: 30-135 [INCOMPLETE]                                                  -----------------------------------------------1.5a Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------Exon 1.3  PDB: A:135-140 (gaps) UniProt: 135-183 --- Transcript 1 (2)
                 2aw2 A  34 CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVK-------------------------------------------HHHHHH 143
                                    43        53        63        73        83        93       103       113       123       133   |     -         -         -         -       140   
                                                                                                                                 137                                         138     

Chain B from PDB  Type:PROTEIN  Length:100
 aligned with TNR14_HUMAN | Q92956 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:102
                                    49        59        69        79        89        99       109       119       129       139  
          TNR14_HUMAN    40 PSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAY 141
               SCOP domains d2aw2b1 B:2-59 Cellular receptor HveA                     d2aw2b2 B:60-103 Cellular recepto  r HveA    SCOP domains
               CATH domains 2aw2B01 B:2-57                                          2aw2B02 B:58-103                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeee..eeee.....eeeee.......eeeee....ee..........ee....hhhh.eeeee........eeee...eeeee.--....eeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                PROSITE (1) -TNFR_NGFR_2  PDB: B:3-37           -TNFR_NGFR_2  PDB: B:39-81 UniProt: 77-119  ---------------------- PROSITE (1)
                PROSITE (2) --------------------------------------TNFR_NGFR_1  PDB: B:40-81 UniProt: 78-119 ---------------------- PROSITE (2)
           Transcript 2 (1) Exon 2.4b  PDB: B:2-2-----------------------------------------Exon 2.5j  PDB: B:64-103 (gaps)          Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.5a  PDB: B:22-64 UniProt: 60-102    --------------------------------------- Transcript 2 (2)
                 2aw2 B   2 PSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQ--DHCAACRAY 103
                                    11        21        31        41        51        61        71        81        91|  |   101  
                                                                                                                     92 95        

Chain X from PDB  Type:PROTEIN  Length:107
 aligned with BTLA_HUMAN | Q7Z6A9 from UniProtKB/Swiss-Prot  Length:289

    Alignment length:107
                                    43        53        63        73        83        93       103       113       123       133       
           BTLA_HUMAN    34 CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS 140
               SCOP domains d2aw2x_ X: B- and T-lymphocyte attenuator CD272                                                             SCOP domains
               CATH domains 2aw2X00 X:34-140 Immunoglobulins                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....eeeeee....eeeeeeee......eeeeeee....eee.....eeeeee..eeeeeeee...hhhhheeeeeeeee..eeee...eeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------V---------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: X:34-135 UniProt: 30-135 [INCOMPLETE]                                                  ----- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------1.3    Transcript 1 (2)
                 2aw2 X  34 CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKHHH 140
                                    43        53        63        73        83        93       103       113       123       133       

Chain Y from PDB  Type:PROTEIN  Length:100
 aligned with TNR14_HUMAN | Q92956 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:102
                                    49        59        69        79        89        99       109       119       129       139  
          TNR14_HUMAN    40 PSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAY 141
               SCOP domains d2aw2y1 Y:2-59 Cellular receptor HveA                     d2aw2y2 Y:60-103 Cellular recepto  r HveA    SCOP domains
               CATH domains 2aw2Y01 Y:2-57                                          2aw2Y02 Y:58-103                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeee..eeee.....eeeee.......eeeee....ee..........ee....hhhh.eeeee........eeee...eeeee.--....eeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                PROSITE (1) -TNFR_NGFR_2  PDB: Y:3-37           -TNFR_NGFR_2  PDB: Y:39-81 UniProt: 77-119  ---------------------- PROSITE (1)
                PROSITE (2) --------------------------------------TNFR_NGFR_1  PDB: Y:40-81 UniProt: 78-119 ---------------------- PROSITE (2)
           Transcript 2 (1) Exon 2.4b  PDB: Y:2-2-----------------------------------------Exon 2.5j  PDB: Y:64-103 (gaps)          Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.5a  PDB: Y:22-64 UniProt: 60-102    --------------------------------------- Transcript 2 (2)
                 2aw2 Y   2 PSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQ--DHCAACRAY 103
                                    11        21        31        41        51        61        71        81        91|  |   101  
                                                                                                                     92 95        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AW2)

(-) Gene Ontology  (30, 34)

Asymmetric Unit(hide GO term definitions)
Chain A,X   (BTLA_HUMAN | Q7Z6A9)
biological process
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,Y   (TNR14_HUMAN | Q92956)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005031    tumor necrosis factor-activated receptor activity    Combining with tumor necrosis factor, a proinflammatory cytokine produced by monocytes and macrophages, to initiate a change in cell function.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0097190    apoptotic signaling pathway    A series of molecular signals which triggers the apoptotic death of a cell. The pathway starts with reception of a signal, and ends when the execution phase of apoptosis is triggered.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0050830    defense response to Gram-positive bacterium    Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0046642    negative regulation of alpha-beta T cell proliferation    Any process that stops, prevents, or reduces the frequency, rate or extent of alpha-beta T cell proliferation.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:2000406    positive regulation of T cell migration    Any process that activates or increases the frequency, rate or extent of T cell migration.
    GO:0002741    positive regulation of cytokine secretion involved in immune response    Any process that activates or increases the frequency, rate, or extent of cytokine secretion contributing to an immune response.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0033209    tumor necrosis factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FUL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:103 - Pro A:104   [ RasMol ]  
    Glu X:103 - Pro X:104   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2aw2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BTLA_HUMAN | Q7Z6A9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TNR14_HUMAN | Q92956
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BTLA_HUMAN | Q7Z6A9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TNR14_HUMAN | Q92956
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNR14_HUMAN | Q929561jma 4fhq 4rsu

(-) Related Entries Specified in the PDB File

1jma CRYSTAL STRUCTURE OF THE GD-HVEM COMPLEX
1xau CRYSTAL STRUCTURE OF MURINE BTLA