Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF UNPHOSPHORYLATED HUMAN PHOSPHOLAMBAN PENTAMER
 
Authors :  K. Oxenoid, J. J. Chou
Date :  06 May 05  (Deposition) - 09 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C,D,E  (20x)
Keywords :  Pentamer, Leu/Ile Zipper, Super Coil, Channel, Membrane Protein/Signaling Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Oxenoid, J. J. Chou
The Structure Of Phospholamban Pentamer Reveals A Channel-Like Architecture In Membranes
Proc. Natl. Acad. Sci. Usa V. 102 10870 2005
PubMed-ID: 16043693  |  Reference-DOI: 10.1073/PNAS.0504920102
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CARDIAC PHOSPHOLAMBAN
    Chains: A, B, C, D, E
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PMALC2X
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PLN
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PLB

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZLL)

(-) Sites  (0, 0)

(no "Site" information available for 1ZLL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZLL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZLL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 15)

NMR Structure (3, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_025989R9CPPLA_HUMANDisease (CMD1P)111033559A/B/C/D/ER9C
2UniProtVAR_072925R9HPPLA_HUMANDisease (CMD1P)754782171A/B/C/D/ER9H
3UniProtVAR_072926R9LPPLA_HUMANDisease (CMD1P)  ---A/B/C/D/ER9L
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZLL)

(-) Exons   (1, 5)

NMR Structure (1, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003575251ENSE00001447253chr6:118869461-11886955595PPLA_HUMAN-00--
1.2ENST000003575252ENSE00001432691chr6:118879988-1188818931906PPLA_HUMAN1-85855A:1-52
B:1-52
C:1-52
D:1-52
E:1-52		52
52
52
52
52

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:52
 aligned with PPLA_HUMAN | P26678 from UniProtKB/Swiss-Prot  Length:52

    Alignment length:52
                                    10        20        30        40        50  
            PPLA_HUMAN    1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains 1zllA00 A:1-52  [code=1.20.5.290, no name defined]   CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------C------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------L------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: A:1-52 UniProt: 1-85 [INCOMPLETE]     Transcript 1
                  1zll A  1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
                                    10        20        30        40        50  


Chain B from PDB  Type:PROTEIN  Length:52
 aligned with PPLA_HUMAN | P26678 from UniProtKB/Swiss-Prot  Length:52

    Alignment length:52
                                    10        20        30        40        50  
            PPLA_HUMAN    1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains 1zllB00 B:1-52  [code=1.20.5.290, no name defined]   CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------C------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------L------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: B:1-52 UniProt: 1-85 [INCOMPLETE]     Transcript 1
                  1zll B  1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
                                    10        20        30        40        50  


Chain C from PDB  Type:PROTEIN  Length:52
 aligned with PPLA_HUMAN | P26678 from UniProtKB/Swiss-Prot  Length:52

    Alignment length:52
                                    10        20        30        40        50  
            PPLA_HUMAN    1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains 1zllC00 C:1-52  [code=1.20.5.290, no name defined]   CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------C------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------L------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: C:1-52 UniProt: 1-85 [INCOMPLETE]     Transcript 1
                  1zll C  1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
                                    10        20        30        40        50  


Chain D from PDB  Type:PROTEIN  Length:52
 aligned with PPLA_HUMAN | P26678 from UniProtKB/Swiss-Prot  Length:52

    Alignment length:52
                                    10        20        30        40        50  
            PPLA_HUMAN    1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains 1zllD00 D:1-52  [code=1.20.5.290, no name defined]   CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------C------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------L------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: D:1-52 UniProt: 1-85 [INCOMPLETE]     Transcript 1
                  1zll D  1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
                                    10        20        30        40        50  


Chain E from PDB  Type:PROTEIN  Length:52
 aligned with PPLA_HUMAN | P26678 from UniProtKB/Swiss-Prot  Length:52

    Alignment length:52
                                    10        20        30        40        50  
            PPLA_HUMAN    1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains 1zllE00 E:1-52  [code=1.20.5.290, no name defined]   CATH domains
           Pfam domains (1) Phospholamban-1zllE01 E:1-52                         Pfam domains (1)
           Pfam domains (2) Phospholamban-1zllE02 E:1-52                         Pfam domains (2)
           Pfam domains (3) Phospholamban-1zllE03 E:1-52                         Pfam domains (3)
           Pfam domains (4) Phospholamban-1zllE04 E:1-52                         Pfam domains (4)
           Pfam domains (5) Phospholamban-1zllE05 E:1-52                         Pfam domains (5)
         Sec.struct. author .hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------C------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------L------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: E:1-52 UniProt: 1-85 [INCOMPLETE]     Transcript 1
                  1zll E  1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1ZLL)

(-) CATH Domains  (1, 5)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 5)

NMR Structure
(-)
Clan: no clan defined [family: Phospholamban] (4)

(-) Gene Ontology  (54, 54)

NMR Structure(hide GO term definitions)
Chain A,B,C,D,E   (PPLA_HUMAN | P26678)
molecular function
    GO:0051117    ATPase binding    Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
    GO:0042030    ATPase inhibitor activity    Stops, prevents or reduces the activity of any enzyme that catalyzes the hydrolysis of ATP to ADP and orthophosphate.
    GO:0005246    calcium channel regulator activity    Modulates the activity of a calcium channel.
    GO:0004857    enzyme inhibitor activity    Binds to and stops, prevents or reduces the activity of an enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0086023    adrenergic receptor signaling pathway involved in heart process    A series of molecular signals beginning with a G-protein coupled adrenergic cell surface receptor combining with epinephrine or norepinephrine, which contributes to a circulatory system process carried out by the heart.
    GO:0008015    blood circulation    The flow of blood through the body of an animal, enabling the transport of nutrients to the tissues and the removal of waste products.
    GO:0006816    calcium ion transport    The directed movement of calcium (Ca) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0048738    cardiac muscle tissue development    The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
    GO:0006874    cellular calcium ion homeostasis    Any process involved in the maintenance of an internal steady state of calcium ions at the level of a cell.
    GO:0032780    negative regulation of ATPase activity    Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
    GO:1901877    negative regulation of calcium ion binding    Any process that stops, prevents or reduces the frequency, rate or extent of calcium ion binding.
    GO:0090281    negative regulation of calcium ion import    Any process that decreases the rate, frequency, or extent of the directed movement of calcium ions into a cell or organelle.
    GO:1902081    negative regulation of calcium ion import into sarcoplasmic reticulum    Any process that stops, prevents or reduces the frequency, rate or extent of calcium ion import into sarcoplasmic reticulum.
    GO:1901020    negative regulation of calcium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of calcium ion transmembrane transporter activity.
    GO:0051926    negative regulation of calcium ion transport    Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1901895    negative regulation of calcium-transporting ATPase activity    Any process that stops, prevents or reduces the frequency, rate or extent of calcium-transporting ATPase activity.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0045822    negative regulation of heart contraction    Any process that stops, prevents, or reduces the frequency, rate or extent of heart contraction.
    GO:0010459    negative regulation of heart rate    Any process that stops, prevents or reduces the frequency or rate of heart contraction.
    GO:0051260    protein homooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0090279    regulation of calcium ion import    Any process that modulates the rate, frequency, or extent of the directed movement of calcium ions into a cell or organelle.
    GO:0051924    regulation of calcium ion transport    Any process that modulates the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1901894    regulation of calcium-transporting ATPase activity    Any process that modulates the frequency, rate or extent of calcium-transporting ATPase activity.
    GO:1903779    regulation of cardiac conduction    Any process that modulates the frequency, rate or extent of cardiac conduction.
    GO:0086004    regulation of cardiac muscle cell contraction    Any process that modulates the frequency, rate or extent of cardiac muscle cell contraction.
    GO:0086036    regulation of cardiac muscle cell membrane potential    Any process that modulates the establishment or extent of a membrane potential in a cardiac muscle cell (a cardiomyocyte). A membrane potential is the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0010881    regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion    Any process that modulates the frequency, rate or extent of cardiac muscle contraction via the regulation of the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol. The sarcoplasmic reticulum is the endoplasmic reticulum of striated muscle, specialised for the sequestration of calcium ions that are released upon receipt of a signal relayed by the T tubules from the neuromuscular junction.
    GO:0051480    regulation of cytosolic calcium ion concentration    Any process involved in the maintenance of an internal steady state of calcium ions within the cytosol of a cell or between the cytosol and its surroundings.
    GO:0008016    regulation of heart contraction    Any process that modulates the frequency, rate or extent of heart contraction. Heart contraction is the process in which the heart decreases in volume in a characteristic way to propel blood through the body.
    GO:1901897    regulation of relaxation of cardiac muscle    Any process that modulates the frequency, rate or extent of relaxation of cardiac muscle.
    GO:1901077    regulation of relaxation of muscle    Any process that modulates the frequency, rate or extent of relaxation of muscle.
    GO:0010880    regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum    Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
    GO:0060314    regulation of ryanodine-sensitive calcium-release channel activity    Any process that modulates the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0002026    regulation of the force of heart contraction    Any process that modulates the extent of heart contraction, changing the force with which blood is propelled.
    GO:0086092    regulation of the force of heart contraction by cardiac conduction    A cardiac conduction process that modulates the extent of heart contraction, changing the force with which blood is propelled.
    GO:0055119    relaxation of cardiac muscle    The process in which the extent of cardiac muscle contraction is reduced.
    GO:0032868    response to insulin    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0033574    response to testosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
    GO:0010043    response to zinc ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
cellular component
    GO:0090534    calcium ion-transporting ATPase complex    Protein complex that carries out the reaction: ATP + H2O + Ca2+(out) = ADP + phosphate + Ca2+(in).
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031966    mitochondrial membrane    Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0016529    sarcoplasmic reticulum    A fine reticular network of membrane-limited elements that pervades the sarcoplasm of a muscle cell; continuous over large portions of the cell and with the nuclear envelope; that part of the endoplasmic reticulum specialized for calcium release, uptake and storage.
    GO:0033017    sarcoplasmic reticulum membrane    The lipid bilayer surrounding the sarcoplasmic reticulum.
    GO:0031982    vesicle    Any small, fluid-filled, spherical organelle enclosed by membrane.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1zll)
 
  Sites
(no "Sites" information available for 1zll)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zll)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zll
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PPLA_HUMAN | P26678
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  609909
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PPLA_HUMAN | P26678
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PPLA_HUMAN | P26678: 1k9n 1kch 1pln 1plp 1psl 2hyn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZLL)