1ZJ6 - JenaLib

Title :   CRYSTAL STRUCTURE OF HUMAN ARL5

Authors :   Z. X. Wang, L. Shi, J. F. Liu, X. M. An, W. R. Chang, D. C. Liang

Date :   28 Apr 05 (Deposition) - 07 Jun 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)
Biol. Unit 3: A  (2x)

Keywords :   Arl, Gtp-Binding, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Z. X. Wang, L. Shi, J. F. Liu, X. M. An, W. R. Chang, D. C. Liang
2. 0A Crystal Structure Of Human Arl5-Gdp3'P, A Novel Member Of The Small Gtp-Binding Proteins
Biochem. Biophys. Res. Commun. V. 332 640 2005
PubMed-ID: 15896705 | Reference-DOI: 10.1016/J.BBRC.2005.04.168

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Asymmetric Unit (2, 3)

No.	Name	Count	Type	Full Name
1	G3D	1	Ligand/Ion	GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	G3D	1	Ligand/Ion	GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 6)

No.	Name	Count	Type	Full Name
1	G3D	2	Ligand/Ion	GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE
2	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 3 (2, 6)

No.	Name	Count	Type	Full Name
1	G3D	2	Ligand/Ion	GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE
2	SO4	4	Ligand/Ion	SULFATE ION

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:95 , ARG A:96 , GLU A:97 , ARG A:103 , LYS A:143 , HOH A:198 , HOH A:201 , HOH A:223 , HOH A:229	BINDING SITE FOR RESIDUE SO4 A 188
2	AC2	SOFTWARE	GLU A:163 , GLY A:164 , LEU A:165 , CYS A:166 , GLN A:167 , HOH A:192 , HOH A:200	BINDING SITE FOR RESIDUE SO4 A 189
3	AC3	SOFTWARE	ASP A:25 , ASN A:26 , ALA A:27 , GLY A:28 , LYS A:29 , THR A:30 , THR A:31 , ASN A:125 , LYS A:126 , ASP A:128 , VAL A:129 , CYS A:158 , ALA A:159 , LEU A:160 , HOH A:222 , HOH A:253 , HOH A:265	BINDING SITE FOR RESIDUE G3D A 190

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARF	PS51417	small GTPase Arf family profile.	ARL5A_HUMAN	10-176	1	A:10-176

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARF	PS51417	small GTPase Arf family profile.	ARL5A_HUMAN	10-176	1	A:10-176

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARF	PS51417	small GTPase Arf family profile.	ARL5A_HUMAN	10-176	2	A:10-176

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARF	PS51417	small GTPase Arf family profile.	ARL5A_HUMAN	10-176	2	A:10-176

Exons (6, 6)

Asymmetric Unit (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1d	ENST00000295087	1d	ENSE00001364904	chr2:152685002-152684645	358	ARL5A_HUMAN	1-16	16	1	A:2-16	15
1.3a	ENST00000295087	3a	ENSE00001655660	chr2:152671713-152671653	61	ARL5A_HUMAN	16-36	21	1	A:16-36	21
1.4	ENST00000295087	4	ENSE00001724503	chr2:152670830-152670683	148	ARL5A_HUMAN	36-85	50	1	A:36-85 (gaps)	50
1.5	ENST00000295087	5	ENSE00001070294	chr2:152668954-152668871	84	ARL5A_HUMAN	86-113	28	1	A:86-113	28
1.7	ENST00000295087	7	ENSE00001795074	chr2:152663486-152663335	152	ARL5A_HUMAN	114-164	51	1	A:114-164	51
1.8d	ENST00000295087	8d	ENSE00001827771	chr2:152659838-152655316	4523	ARL5A_HUMAN	164-179	16	1	A:164-178	15

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:173
 aligned with ARL5A_HUMAN | Q9Y689 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:177
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       
          ARL5A_HUMAN     2 GILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKI 178
               SCOP domains d1zj6a1 A:2-178 ADP-ribosylation factor                                                                                                                                           SCOP domains
               CATH domains 1zj6A00 A:2-178 P-loop containing nucleotide triphosphate hydrolases                                                                                                              CATH domains
               Pfam domains ---Arf-1zj6A01 A:5-176                                                                                                                                                         -- Pfam domains
         Sec.struct. author hhhhhhhhhhhh...eeeeeee....hhhhhhhhhhh...eeee.......eeeee..eeeeeee...----hhhhhhhh....eeeeeee.....hhhhhhhhhhhhhhhhhhh..eeeeeee........hhhhhhhhhhhhhh....eeeee.......hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------ARF  PDB: A:10-176 UniProt: 10-176                                                                                                                                     -- PROSITE
           Transcript 1 (1) Exon 1.1d      -------------------Exon 1.4  PDB: A:36-85 (gaps) UniProt: 36-85      Exon 1.5  PDB: A:86-113     Exon 1.7  PDB: A:114-164 UniProt: 114-164          -------------- Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.3a            -------------------------------------------------------------------------------------------------------------------------------Exon 1.8d       Transcript 1 (2)
                 1zj6 A   2 GILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGG----RSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKI 178
                                    11        21        31        41        51        61       | -  |     81        91       101       111       121       131       141       151       161       171       
                                                                                              69   74

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (4, 4)

Asymmetric Unit(hide GO term definitions)

Chain A (ARL5A_HUMAN | Q9Y689)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		G3D	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zj6)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1zj6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARL5A_HUMAN \| Q9Y689
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARL5A_HUMAN \| Q9Y689
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description