Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HUMAN LACTOFERRICIN
 
Authors :  H. N. Hunter, A. R. Demcoe, H. Jenssen, T. J. Gutteberg, H. J. Vogel
Date :  23 Mar 05  (Deposition) - 16 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Helical, Antimicrobial Peptide, Aqueous, Antimicrobial Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. N. Hunter, A. R. Demcoe, H. Jenssen, T. J. Gutteberg, H. J. Vogel
Human Lactoferricin Is Partially Folded In Aqueous Solution And Is Better Stabilized In A Membrane Mimetic Solvent
Antimicrob. Agents Chemother. V. 49 3387 2005
PubMed-ID: 16048952  |  Reference-DOI: 10.1128/AAC.49.8.3387-3395.2005
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - LACTOTRANSFERRIN
    ChainsA
    FragmentN-TERMINAL PEPTIDE
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsMILK

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Z6W)

(-) Sites  (0, 0)

(no "Site" information available for 1Z6W)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:10 -A:46
2A:20 -A:37

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Z6W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

NMR Structure (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013504A29TTRFL_HUMANPolymorphism1126477AA11T
2UniProtVAR_013505K47RTRFL_HUMANPolymorphism1126478AK29R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRANSFERRIN_LIKE_4PS51408 Transferrin-like domain profile.TRFL_HUMAN25-352
364-695
  1A:7-49
-

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.5aENST000002317515aENSE00001814982chr3:46506653-46506315339TRFL_HUMAN1-15150--
1.8bENST000002317518bENSE00001591766chr3:46501309-46501146164TRFL_HUMAN15-69551A:1-4949
1.9ENST000002317519ENSE00001078630chr3:46497888-46497780109TRFL_HUMAN70-106370--
1.10aENST0000023175110aENSE00002201536chr3:46497468-46497286183TRFL_HUMAN106-167620--
1.12bENST0000023175112bENSE00001078629chr3:46496932-46496785148TRFL_HUMAN167-216500--
1.13aENST0000023175113aENSE00000825947chr3:46495850-4649579556TRFL_HUMAN216-235200--
1.14ENST0000023175114ENSE00000825946chr3:46492163-46491985179TRFL_HUMAN235-294600--
1.15ENST0000023175115ENSE00000767141chr3:46491518-46491344175TRFL_HUMAN295-353590--
1.16bENST0000023175116bENSE00000767140chr3:46490508-46490354155TRFL_HUMAN353-404520--
1.17ENST0000023175117ENSE00000492524chr3:46488889-4648879991TRFL_HUMAN405-435310--
1.18ENST0000023175118ENSE00000767138chr3:46487984-4648793154TRFL_HUMAN435-453190--
1.19ENST0000023175119ENSE00000492526chr3:46486927-46486772156TRFL_HUMAN453-505530--
1.20ENST0000023175120ENSE00000492527chr3:46485073-46484932142TRFL_HUMAN505-552480--
1.22aENST0000023175122aENSE00000767135chr3:46482974-4648290768TRFL_HUMAN552-575240--
1.23aENST0000023175123aENSE00001292001chr3:46480971-46480787185TRFL_HUMAN575-636620--
1.24cENST0000023175124cENSE00000825945chr3:46479620-46479431190TRFL_HUMAN637-700640--
1.25cENST0000023175125cENSE00001289842chr3:46477720-46477136585TRFL_HUMAN700-710110--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:49
 aligned with TRFL_HUMAN | P02788 from UniProtKB/Swiss-Prot  Length:710

    Alignment length:49
                                    28        38        48        58         
            TRFL_HUMAN   19 AGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA 67
               SCOP domains ------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------- CATH domains
               Pfam domains ------Transferrin-1z6wA01 A:7-49                  Pfam domains
         Sec.struct. author ........hhhhhh................................... Sec.struct. author
                 SAPs(SNPs) ----------T-----------------R-------------------- SAPs(SNPs)
                    PROSITE ------TRANSFERRIN_LIKE_4  PDB: A:7-49             PROSITE
               Transcript 1 Exon 1.8b  PDB: A:1-49 UniProt: 15-69             Transcript 1
                  1z6w A  1 GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA 49
                                    10        20        30        40         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1Z6W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1Z6W)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: PBP (391)

(-) Gene Ontology  (57, 57)

NMR Structure(hide GO term definitions)
Chain A   (TRFL_HUMAN | P02788)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043539    protein serine/threonine kinase activator activity    Binds to and increases the activity of a protein serine/threonine kinase.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0019731    antibacterial humoral response    An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster.
    GO:0019732    antifungal humoral response    An immune response against a fungus mediated through a body fluid. An example of this process is the antifungal humoral response in Drosophila melanogaster.
    GO:0060349    bone morphogenesis    The process in which bones are generated and organized.
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0006959    humoral immune response    An immune response mediated through a body fluid.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0002227    innate immune response in mucosa    Any process of the innate immune response that takes place in the mucosal tissues.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0033214    iron assimilation by chelation and transport    A process in which iron (Fe3+) is solubilized by ferric iron-specific chelators, known as siderophores, excreted by a cell; the iron-siderophore complex is then transported into the cell by specific cell surface receptors.
    GO:0055072    iron ion homeostasis    Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
    GO:0044793    negative regulation by host of viral process    A process in which a host organism stops, prevents or reduces the frequency, rate or extent of a process being mediated by a virus with which it is infected.
    GO:0032780    negative regulation of ATPase activity    Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0031665    negative regulation of lipopolysaccharide-mediated signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of signaling in response to detection of lipopolysaccharide.
    GO:2001205    negative regulation of osteoclast development    Any process that stops, prevents or reduces the frequency, rate or extent of osteoclast development.
    GO:1900229    negative regulation of single-species biofilm formation in or on host organism    Any process that stops, prevents or reduces the frequency, rate or extent of single-species biofilm formation in or on host organism.
    GO:2000308    negative regulation of tumor necrosis factor (ligand) superfamily member 11 production    Any process that stops, prevents or reduces the frequency, rate or extent of tumor necrosis factor (ligand) superfamily member 11 production.
    GO:0045071    negative regulation of viral genome replication    Any process that stops, prevents, or reduces the frequency, rate or extent of viral genome replication.
    GO:0048525    negative regulation of viral process    Any process that stops, prevents, or reduces the frequency, rate or extent of a multi-organism process in which a virus is a participant.
    GO:0001503    ossification    The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:1900159    positive regulation of bone mineralization involved in bone maturation    Any process that activates or increases the frequency, rate or extent of bone mineralization involved in bone maturation.
    GO:1902732    positive regulation of chondrocyte proliferation    Any process that increases the frequency, rate or extent of the multiplication or reproduction of chondrocytes by cell division, resulting in the expansion of their population. A chondrocyte is a polymorphic cell that forms cartilage.
    GO:0045669    positive regulation of osteoblast differentiation    Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
    GO:0033690    positive regulation of osteoblast proliferation    Any process that activates or increases the rate or extent of osteoblast proliferation.
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0034145    positive regulation of toll-like receptor 4 signaling pathway    Any process that activates or increases the frequency, rate, or extent of toll-like receptor 4 signaling pathway.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0001817    regulation of cytokine production    Any process that modulates the frequency, rate, or extent of production of a cytokine.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0032680    regulation of tumor necrosis factor production    Any process that modulates the frequency, rate, or extent of tumor necrosis factor production.
    GO:0001895    retina homeostasis    A tissue homeostatic process involved in the maintenance of an internal equilibrium within the retina of the eye, including control of cellular proliferation and death and control of metabolic function.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0097013    phagocytic vesicle lumen    The volume enclosed by the membrane of a phagocytic vesicle.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0030141    secretory granule    A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.
    GO:0042581    specific granule    Granule with a membranous, tubular internal structure, found primarily in mature neutrophil cells. Most are released into the extracellular fluid. Specific granules contain lactoferrin, lysozyme, vitamin B12 binding protein and elastase.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1z6w)
 
  Sites
(no "Sites" information available for 1z6w)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z6w)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1z6w
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRFL_HUMAN | P02788
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRFL_HUMAN | P02788
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRFL_HUMAN | P027881b0l 1bka 1cb6 1dsn 1eh3 1fck 1h43 1h44 1h45 1hse 1l5t 1lcf 1lct 1lfg 1lfh 1lfi 1lgb 1n76 1sqy 1u62 1vfd 1vfe 1xv4 1xv7 1z6v 2bjj 2dp4 2gmc 2gmd 2hd4 2pms

(-) Related Entries Specified in the PDB File

1lfc SAME PROTEIN SOURCE BOVINE
1z6v SAME PROTEIN IN A MEMBRANE MIMETIC SOLVENT