1Z52 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   PROAEROLYSIN MUTANT W373L

Authors :   M. W. Parker, S. C. Feil, J. W. Tang

Date :   16 Mar 05 (Deposition) - 07 Mar 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.38

Chains :   Asym./Biol. Unit : A,B

Keywords :   Toxin, Hemolytic Polypeptide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. W. Parker, S. C. Feil, J. W. Tang
Crystal Structure Of Proaerolysin At 2. 3 A Resolution And Structural Analyses Of Single-Site Mutants As A Basis For Understanding Membrane Insertion Of The Toxin
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - AEROLYSIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PRK2013
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Mutation	:	YES
	Organism Scientific	:	AEROMONAS HYDROPHILA
	Organism Taxid	:	644

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1Z52)

(no "Site" information available for 1Z52)

Asymmetric/Biological Unit

No.	Residues
1	A:19	-	A:75
2	A:159	-	A:164
3	B:19	-	B:75
4	B:159	-	B:164

(no "Cis Peptide Bond" information available for 1Z52)

(no "SAP(SNP)/Variant" information available for 1Z52)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	AEROLYSIN	PS00274	Aerolysin type toxins signature.	AERA_AERHY	246-255	2	A:223-232 B:223-232

(no "Exon" information available for 1Z52)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:451
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:467
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       
           AERA_AERHY    26 PVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAAN 492
               SCOP domains d1z52a1 A:3-84 automated matches                                                  d1z52a2 A:85-469 automated matches                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1z52A01 A:3-90 Pertussis Toxin, subunit B, domain 1                                     1z52A02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                            1z52A03 A:177-310,A:398-469 Proaerolysin, chain A, domain 3                                                                           1z52A02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                             1z52A03 A:177-310,A:398-46                9 Proaerolysin, chain A, domai CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhheee..........eee.hhhhhhhhhhhhhh......eeee...eeee.hhhh..eee.....eeeee.............eee...hhhhhhhhhhh....hhhhhhhhhhhh................eeeee....eeeee...............eeeeeeeeeeeeeeeeee.......eeeeeeeeeeeee........eeeeeeeeeeeeeee...hhhhh.ee....ee...........ee....hhhhh.eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee........hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeeeeeee...ee...ee..----------------..eee...hhhhhhhh..eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1z52 A   3 PVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDLNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLA----------------GLRLEIPLDAQELSGLGFNNVSLSVTPAAN 469
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422|        -       442       452       462       
                                                                                                                                                                                                                                                                                                                                                                                                                                                              423              440

Chain B from PDB  Type:PROTEIN  Length:450
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:467
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       
           AERA_AERHY    24 AEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPA 490
               SCOP domains d1z52b1 B:1-84 automated matches                                                    d1z52b2 B:85-467 automated matches                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1z52B01 B:1-90 Pertussis Toxin, subunit B, domain 1                                       1z52B02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                            1z52B03 B:177-310,B:398-467 Proaerolysin, chain A, domain 3                                                                           1z52B02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                             1z52B03 B:177-310,B:398-46                 7 Proaerolysin, chain A, do CATH domains
           Pfam domains (1) APT-1z52B03 B:1-83                                                                 ------------Aerolysin-1z52B01 B:96-454                                                                                                                                                                                                                                                                                                                                             ------------- Pfam domains (1)
           Pfam domains (2) APT-1z52B04 B:1-83                                                                 ------------Aerolysin-1z52B02 B:96-454                                                                                                                                                                                                                                                                                                                                             ------------- Pfam domains (2)
         Sec.struct. author ....hhhhheee..........eee.hhhhhhhhhhhhhh......eeee...eeee.hhhh..eee.....eeeee.............eee...hhhhhhhhhhh....hhhhhhhhhhhh................eeeeee..eeeeee...............eeeeeeeeeeeeeeeeee....eeeeeeeeeeeeeee.........eeeeeeee.eeeeee....hhhh.ee....ee...........ee....hhhhh.eeeee..eeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee....hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeeeeeee...ee...ee..-----------------.eee...hhhhhhhhh.eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1z52 B   1 AEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDLNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLA-----------------LRLEIPLDAQELSGLGFNNVSLSVTPA 467
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420  |      -         -|      450       460       
                                                                                                                                                                                                                                                                                                                                                                                                                                                                423               441

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Proaerolysin; Chain A, domain 2 (7)

Homologous Superfamily: Proaerolysin, chain A, domain 2 (7)

Aeromonas hydrophila. Organism_taxid: 644. (2)

1a	1z52A02	A:91-176,A:311-397
1b	1z52B02	B:91-176,B:311-397

Architecture: Roll (3276)

Topology: Pertussis Toxin; Chain B, domain 1 (10)

Homologous Superfamily: Pertussis Toxin, subunit B, domain 1 (10)

Aeromonas hydrophila. Organism_taxid: 644. (2)

2a	1z52A01	A:3-90
2b	1z52B01	B:1-90

Class: Mainly Beta (13760)

Architecture: Beta Complex (381)

Topology: Proaerolysin; Chain A, domain 3 (10)

Homologous Superfamily: Proaerolysin, chain A, domain 3 (10)

Aeromonas hydrophila. Organism_taxid: 644. (2)

3a	1z52B03	B:177-310,B:398-467
3b	1z52A03	A:177-310,A:398-469

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Aerolisin_ETX (6)

Family: Aerolysin (2)

Aeromonas hydrophila (2)

1a	Aerolysin-1z52B01	B:96-454
1b	Aerolysin-1z52B02	B:96-454

Clan: C_Lectin (98)

Family: APT (4)

Aeromonas hydrophila (2)

2a	APT-1z52B03	B:1-83
2b	APT-1z52B04	B:1-83

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (AERA_AERHY | P09167)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1z52)

	Sites
(no "Sites" information available for 1z52)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z52)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z52
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AERA_AERHY \| P09167
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AERA_AERHY \| P09167
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AERA_AERHY \| P09167	:	1pre 3c0m 3c0n 3c0o 3g4n 3g4o 5jzh 5jzt 5jzw

1pre	WILD TYPE PROAEROLYSIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (3, 6)

Pfam Domains (2, 4)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File