1Z29 - JenaLib

Title :   CRYSTAL STRUCTURES OF SULT1A2 AND SULT1A1*3: IMPLICATIONS IN THE BIOACTIVATION OF N-HYDROXY-2-ACETYLAMINO FLUORINE (OH-AAF)

Authors :   J. Lu, H. Li, M. C. Liu, J. Zhang, M. Li, X. An, W. Chang

Date :   07 Mar 05 (Deposition) - 30 May 06 (Release) - 25 Aug 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Sult1A2, Pap, Cation-Pi Interaction, Plastic Substrate Binding Pocket, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Lu, H. Li, J. Zhang, M. Li, M. Y. Liu, X. An, M. C. Liu, W. Chang
Crystal Structures Of Sult1A2 And Sult1A1 *3: Insights Into The Substrate Inhibition And The Role Of Tyr149 In Sult1A2.
Biochem. Biophys. Res. Commun. V. 396 429 2010
PubMed-ID: 20417180 | Reference-DOI: 10.1016/J.BBRC.2010.04.109

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 5)

Asymmetric Unit (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_057340	P	19	L	ST1A2_HUMAN	Polymorphism	10797300	A	P	19	L
2	UniProt	VAR_057341	Y	62	F	ST1A2_HUMAN	Polymorphism	4987024	A	Y	62	F
3	UniProt	VAR_007427	N	235	T	ST1A2_HUMAN	Polymorphism	1059491	A	N	235	T
4	UniProt	VAR_057342	N	239	S	ST1A2_HUMAN	Polymorphism	45472392	A	N	239	S
5	UniProt	VAR_061887	K	282	E	ST1A2_HUMAN	Polymorphism	27742	A	E	282	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_057340	P	19	L	ST1A2_HUMAN	Polymorphism	10797300	A	P	19	L
2	UniProt	VAR_057341	Y	62	F	ST1A2_HUMAN	Polymorphism	4987024	A	Y	62	F
3	UniProt	VAR_007427	N	235	T	ST1A2_HUMAN	Polymorphism	1059491	A	N	235	T
4	UniProt	VAR_057342	N	239	S	ST1A2_HUMAN	Polymorphism	45472392	A	N	239	S
5	UniProt	VAR_061887	K	282	E	ST1A2_HUMAN	Polymorphism	27742	A	E	282	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (7, 7)

Asymmetric Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000395630	1c	ENSE00001522306	chr16:28607801-28607455	347	ST1A2_HUMAN	-	0	0	-	-
1.1g	ENST00000395630	1g	ENSE00001638355	chr16:28607255-28607104	152	ST1A2_HUMAN	1-50	50	1	A:8-50	43
1.2a	ENST00000395630	2a	ENSE00001759576	chr16:28606996-28606871	126	ST1A2_HUMAN	50-92	43	1	A:50-92 (gaps)	43
1.2c	ENST00000395630	2c	ENSE00001594137	chr16:28606785-28606688	98	ST1A2_HUMAN	92-124	33	1	A:92-124	33
1.3	ENST00000395630	3	ENSE00001597581	chr16:28604889-28604763	127	ST1A2_HUMAN	125-167	43	1	A:125-167	43
1.4b	ENST00000395630	4b	ENSE00001786654	chr16:28604667-28604573	95	ST1A2_HUMAN	167-198	32	1	A:167-198	32
1.5b	ENST00000395630	5b	ENSE00001758609	chr16:28603764-28603584	181	ST1A2_HUMAN	199-259	61	1	A:199-259	61
1.6a	ENST00000395630	6a	ENSE00001260060	chr16:28603461-28603266	196	ST1A2_HUMAN	259-295	37	1	A:259-295	37

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:281
 aligned with ST1A2_HUMAN | P50226 from UniProtKB/Swiss-Prot  Length:295

    Alignment length:288
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287        
          ST1A2_HUMAN     8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL 295
               SCOP domains d1z29a_ A: automated matches                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1z29A00 A:8-295 P-loop containing nucleotide triphosphate        hydrolases                                                                                                                                                                                                                      CATH domains
               Pfam domains ------------------------------Sulfotransfer_1-1z29A01 A:38       -288                                                                                                                                                                                                                    ------- Pfam domains
         Sec.struct. author .....eee..eeehhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..-------.hhhhhh...........hhhhhh.......eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..........................hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) -----------L------------------------------------------F----------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---S------------------------------------------E------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1g  PDB: A:8-50 UniProt: 1-50       -----------------------------------------Exon 1.2c  PDB: A:92-124         Exon 1.3  PDB: A:125-167 UniProt: 125-167  -------------------------------Exon 1.5b  PDB: A:199-259 UniProt: 199-259                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.2a  PDB: A:50-92 (gaps)             --------------------------------------------------------------------------Exon 1.4b  PDB: A:167-198       ------------------------------------------------------------Exon 1.6a  PDB: A:259-295             Transcript 1 (2)
                 1z29 A   8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGG-------APIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL 295
                                    17        27        37        47        57       | -     |  77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287        
                                                                                    65      73

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (15, 15)

Asymmetric Unit(hide GO term definitions)

Chain A (ST1A2_HUMAN | P50226)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0047894	flavonol 3-sulfotransferase activity	Catalysis of the reaction: 3'-phospho-5'-adenylyl sulfate + quercetin = adenosine 3',5'-diphosphate + H(+) + quercetin 3-sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0009309	amine biosynthetic process	The chemical reactions and pathways resulting in the formation of any organic compound that is weakly basic in character and contains an amino or a substituted amino group. Amines are called primary, secondary, or tertiary according to whether one, two, or three carbon atoms are attached to the nitrogen atom.
	GO:0006584	catecholamine metabolic process	The chemical reactions and pathways involving any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0018958	phenol-containing compound metabolic process	The chemical reactions and pathways involving a phenol, any compound containing one or more hydroxyl groups directly attached to an aromatic carbon ring.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACY	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:101 - Pro A:102	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1z29
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1A2_HUMAN \| P50226
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description