1Z0K - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF GTP-BOUND RAB4Q67L GTPASE IN COMPLEX WITH THE CENTRAL RAB BINDING DOMAIN OF RABENOSYN-5

Authors :   S. Eathiraj, X. Pan, C. Ritacco, D. G. Lambright

Date :   01 Mar 05 (Deposition) - 26 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.92

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Rab Gtpases, Rab4, Rabenosyn, Effector Complex, Vesicular Trafficking, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Eathiraj, X. Pan, C. Ritacco, D. G. Lambright
Structural Basis Of Family-Wide Rab Gtpase Recognition By Rabenosyn-5.
Nature V. 436 415 2005
PubMed-ID: 16034420 | Reference-DOI: 10.1038/NATURE03798
(for further references see the PDB file header)

Molecule 1 - GTP-BINDING PROTEIN
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PET28A
	Expression System Strain	:	BL21 (DE3) CODON PLUS-RIL CELLS
	Expression System Taxid	:	562
	Expression System Vector Type	:	6XHIS FUSION-PET SYSTEM,
	Gene	:	RAB4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - FYVE-FINGER-CONTAINING RAB5 EFFECTOR PROTEIN RABENOSYN-5
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P1
	Expression System Taxid	:	562
	Expression System Vector Type	:	GST FUSION-PGEX SYSTEM
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 5)

No.	Name	Count	Type	Full Name
1	GTP	2	Ligand/Ion	GUANOSINE-5'-TRIPHOSPHATE
2	MES	1	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3	MG	2	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	GTP	1	Ligand/Ion	GUANOSINE-5'-TRIPHOSPHATE
2	MES	-1	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	GTP	1	Ligand/Ion	GUANOSINE-5'-TRIPHOSPHATE
2	MES	1	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:22 , THR A:40 , GTP A:1200 , HOH A:1207 , HOH A:1212	BINDING SITE FOR RESIDUE MG A 1201
2	AC2	SOFTWARE	SER C:22 , THR C:40 , GTP C:2200 , HOH C:2208 , HOH C:2222	BINDING SITE FOR RESIDUE MG C 2201
3	AC3	SOFTWARE	ALA A:17 , GLY A:18 , THR A:19 , GLY A:20 , LYS A:21 , SER A:22 , CYS A:23 , PHE A:33 , SER A:37 , HIS A:39 , THR A:40 , ALA A:65 , GLY A:66 , ASN A:121 , LYS A:122 , ASP A:124 , LEU A:125 , SER A:151 , ALA A:152 , LEU A:153 , MG A:1201 , HOH A:1207 , HOH A:1210 , HOH A:1212 , HOH A:1262 , HOH A:1285 , HOH A:1304 , HOH A:1317 , HOH A:1348 , ASP C:35 , HOH C:2300	BINDING SITE FOR RESIDUE GTP A 1200
4	AC4	SOFTWARE	ALA C:17 , GLY C:18 , THR C:19 , GLY C:20 , LYS C:21 , SER C:22 , CYS C:23 , PHE C:33 , SER C:37 , HIS C:39 , THR C:40 , GLY C:66 , ASN C:121 , LYS C:122 , ASP C:124 , LEU C:125 , SER C:151 , ALA C:152 , LEU C:153 , MG C:2201 , HOH C:2208 , HOH C:2219 , HOH C:2222 , HOH C:2247	BINDING SITE FOR RESIDUE GTP C 2200
5	AC5	SOFTWARE	GLU C:30 , GLY D:442 , TRP D:443 , LEU D:444 , LYS D:474 , MET D:479 , HOH D:1072	BINDING SITE FOR RESIDUE MES D 1001

(no "SS Bond" information available for 1Z0K)

(no "Cis Peptide Bond" information available for 1Z0K)

(no "SAP(SNP)/Variant" information available for 1Z0K)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RAB	PS51419	small GTPase Rab1 family profile.	RAB4A_HUMAN	9-216	1	A:4-172

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RAB	PS51419	small GTPase Rab1 family profile.	RAB4A_HUMAN	9-216	1	A:4-172

Biological Unit 2 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RAB	PS51419	small GTPase Rab1 family profile.	RAB4A_HUMAN	9-216	0	-

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000253699	1b	ENSE00001426996	chr3:15140655-15140542	114	RBNS5_HUMAN	-	0	0	-	-
1.2	ENST00000253699	2	ENSE00001400873	chr3:15139781-15139626	156	RBNS5_HUMAN	-	0	0	-	-
1.3	ENST00000253699	3	ENSE00001399837	chr3:15138217-15138042	176	RBNS5_HUMAN	-	0	0	-	-
1.4b	ENST00000253699	4b	ENSE00002148188	chr3:15137795-15137480	316	RBNS5_HUMAN	1-50	50	0	-	-
1.6	ENST00000253699	6	ENSE00001735576	chr3:15132046-15131906	141	RBNS5_HUMAN	50-97	48	0	-	-
1.7b	ENST00000253699	7b	ENSE00001740707	chr3:15127468-15127368	101	RBNS5_HUMAN	97-130	34	0	-	-
1.8	ENST00000253699	8	ENSE00001646587	chr3:15126552-15126507	46	RBNS5_HUMAN	131-146	16	0	-	-
1.9	ENST00000253699	9	ENSE00001761956	chr3:15126403-15126242	162	RBNS5_HUMAN	146-200	55	0	-	-
1.10b	ENST00000253699	10b	ENSE00001748893	chr3:15124115-15123874	242	RBNS5_HUMAN	200-280	81	0	-	-
1.13	ENST00000253699	13	ENSE00001680530	chr3:15122309-15122239	71	RBNS5_HUMAN	281-304	24	0	-	-
1.14c	ENST00000253699	14c	ENSE00000901297	chr3:15119668-15119582	87	RBNS5_HUMAN	304-333	30	0	-	-
1.15	ENST00000253699	15	ENSE00000901296	chr3:15118671-15118569	103	RBNS5_HUMAN	333-367	35	0	-	-
1.16	ENST00000253699	16	ENSE00000901295	chr3:15117217-15117113	105	RBNS5_HUMAN	368-402	35	0	-	-
1.19e	ENST00000253699	19e	ENSE00001242854	chr3:15116437-15111580	4858	RBNS5_HUMAN	403-784	382	2	B:441-501 D:441-501	61 61

2.1b	ENST00000366690	1b	ENSE00001429124	chr1:229406879-229407117	239	RAB4A_HUMAN	1-11	11	2	A:4-6 C:5-6	3 2
2.2b	ENST00000366690	2b	ENSE00001710894	chr1:229422233-229422313	81	RAB4A_HUMAN	11-38	28	2	A:6-33 C:6-33	28 28
2.3a	ENST00000366690	3a	ENSE00001015822	chr1:229424476-229424590	115	RAB4A_HUMAN	38-76	39	2	A:33-71 C:33-71	39 39
2.5	ENST00000366690	5	ENSE00001671680	chr1:229431595-229431657	63	RAB4A_HUMAN	76-97	22	2	A:71-92 C:71-92	22 22
2.6a	ENST00000366690	6a	ENSE00001015820	chr1:229433229-229433383	155	RAB4A_HUMAN	97-149	53	2	A:92-144 C:92-144	53 53
2.8a	ENST00000366690	8a	ENSE00001442328	chr1:229434724-229434819	96	RAB4A_HUMAN	149-181	33	2	A:144-172 C:144-172	29 29
2.9	ENST00000366690	9	ENSE00001015815	chr1:229438609-229438736	128	RAB4A_HUMAN	181-218	38	0	-	-
2.10c	ENST00000366690	10c	ENSE00001842622	chr1:229439553-229441641	2089	RAB4A_HUMAN	-	0	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:169
 aligned with RAB4A_HUMAN | P20338 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:169
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168         
          RAB4A_HUMAN     9 TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNK 177
               SCOP domains d1z0ka1 A:4-172 Rab4a                                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee..hhhhhhhhhh......eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RAB  PDB: A:4-172 UniProt: 9-216                                                                                                                                          PROSITE
           Transcript 2 (1) 2.1--------------------------Exon 2.3a  PDB: A:33-71 UniProt: 38-76 --------------------Exon 2.6a  PDB: A:92-144 UniProt: 97-149             ---------------------------- Transcript 2 (1)
           Transcript 2 (2) --Exon 2.2b  PDB: A:6-33      -------------------------------------Exon 2.5  PDB: A:71-92---------------------------------------------------Exon 2.8a  PDB: A:144-172     Transcript 2 (2)
                 1z0k A   4 TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGLERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK 172
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163

Chain B from PDB  Type:PROTEIN  Length:61
 aligned with RBNS5_HUMAN | Q9H1K0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:61
                                   450       460       470       480       490       500 
          RBNS5_HUMAN   441 EGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQT 501
               SCOP domains d1z0kb1 B:441-501                                             SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.19e  PDB: B:441-501 UniProt: 403-784 [INCOMPLETE]      Transcript 1
                 1z0k B 441 EGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQT 501
                                   450       460       470       480       490       500

Chain C from PDB  Type:PROTEIN  Length:168
 aligned with RAB4A_HUMAN | P20338 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:168
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169        
          RAB4A_HUMAN    10 YDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNK 177
               SCOP domains d1z0kc_ C: Rab4a                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) Ras-1z0kC01 C:5-166                                                                                                                                               ------ Pfam domains (1)
           Pfam domains (2) Ras-1z0kC02 C:5-166                                                                                                                                               ------ Pfam domains (2)
         Sec.struct. author ..eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee..hhhhhhhhhh......eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee.hhhhhhh..hhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE RAB  PDB: - UniProt: 9-216                                                                                                                                               PROSITE
           Transcript 2 (1) 2.--------------------------Exon 2.3a  PDB: C:33-71 UniProt: 38-76 --------------------Exon 2.6a  PDB: C:92-144 UniProt: 97-149             ---------------------------- Transcript 2 (1)
           Transcript 2 (2) -Exon 2.2b  PDB: C:6-33      -------------------------------------Exon 2.5  PDB: C:71-92---------------------------------------------------Exon 2.8a  PDB: C:144-172     Transcript 2 (2)
                 1z0k C   5 YDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGLERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK 172
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164

Chain D from PDB  Type:PROTEIN  Length:61
 aligned with RBNS5_HUMAN | Q9H1K0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:61
                                   450       460       470       480       490       500 
          RBNS5_HUMAN   441 EGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQT 501
               SCOP domains d1z0kd_ D: automated matches                                  SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
           Pfam domains (1) ------------------Rbsn-1z0kD01 D:459-500                    - Pfam domains (1)
           Pfam domains (2) ------------------Rbsn-1z0kD02 D:459-500                    - Pfam domains (2)
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.19e  PDB: D:441-501 UniProt: 403-784 [INCOMPLETE]      Transcript 1
                 1z0k D 441 EGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQT 501
                                   450       460       470       480       490       500

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 1Z0K)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: Ras (176)

Homo sapiens (Human) (141)

1a	Ras-1z0kC01	C:5-166
1b	Ras-1z0kC02	C:5-166

Clan: no clan defined [family: Rbsn] (2)

Family: Rbsn (2)

Homo sapiens (Human) (2)

2a	Rbsn-1z0kD01	D:459-500
2b	Rbsn-1z0kD02	D:459-500

Asymmetric Unit(hide GO term definitions)

Chain A,C (RAB4A_HUMAN | P20338)

molecular function
	GO:0001671	ATPase activator activity	Binds to and increases the ATP hydrolysis activity of an ATPase.
	GO:0051117	ATPase binding	Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0035255	ionotropic glutamate receptor binding	Interacting selectively and non-covalently with an ionotropic glutamate receptor. Ionotropic glutamate receptors bind glutamate and exert an effect through the regulation of ion channels.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
	GO:0019905	syntaxin binding	Interacting selectively and non-covalently with a syntaxin, a SNAP receptor involved in the docking of synaptic vesicles at the presynaptic zone of a synapse.
biological process
	GO:0032482	Rab protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Rab family of proteins switching to a GTP-bound active state.
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0032781	positive regulation of ATPase activity	Any process that activates or increases the rate of ATP hydrolysis by an ATPase.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0030100	regulation of endocytosis	Any process that modulates the frequency, rate or extent of endocytosis.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0032593	insulin-responsive compartment	A small membrane-bounded vesicle that releases its contents by exocytosis in response to insulin stimulation; the contents are enriched in GLUT4, IRAP and VAMP2.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.
	GO:0031982	vesicle	Any small, fluid-filled, spherical organelle enclosed by membrane.

Chain B,D (RBNS5_HUMAN | Q9H1K0)

molecular function
	GO:0017137	Rab GTPase binding	Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006895	Golgi to endosome transport	The directed movement of substances from the Golgi to early sorting endosomes. Clathrin vesicles transport substances from the trans-Golgi to endosomes.
	GO:0090160	Golgi to lysosome transport	The directed movement of substances from the Golgi to lysosomes.
	GO:0006896	Golgi to vacuole transport	The directed movement of substances from the Golgi to the vacuole.
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0034498	early endosome to Golgi transport	The directed movement of substances from early endosomes to the Golgi.
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0016197	endosomal transport	The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
	GO:0034058	endosomal vesicle fusion	The homotypic fusion of endocytic vesicles to form or add to an early endosome.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1903358	regulation of Golgi organization	Any process that modulates the frequency, rate or extent of Golgi organization.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0000011	vacuole inheritance	The distribution of vacuoles into daughter cells after mitosis or meiosis, mediated by interactions between vacuoles and the cytoskeleton.
cellular component
	GO:0010009	cytoplasmic side of endosome membrane	The side (leaflet) of the endosome membrane that faces the cytoplasm.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GTP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z0k)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z0k
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RAB4A_HUMAN \| P20338
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RBNS5_HUMAN \| Q9H1K0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RAB4A_HUMAN \| P20338
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RBNS5_HUMAN \| Q9H1K0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RAB4A_HUMAN \| P20338	:	1yu9 2bmd 2bme
	RBNS5_HUMAN \| Q9H1K0	:	1yzm 1z0j

(no "Related Entries Specified in the PDB File" available for 1Z0K)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 4)

CATH Domains (0, 0)

Pfam Domains (2, 4)

Gene Ontology (44, 53)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File