1Z08 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   GPPNHP-BOUND RAB21 Q53G MUTANT GTPASE

Authors :   S. Eathiraj, X. Pan, C. Ritacco, D. G. Lambright

Date :   01 Mar 05 (Deposition) - 26 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: C (1x),D (1x)

Keywords :   Rab Gtpase, Rab21, Vesicular Trafficking, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Eathiraj, X. Pan, C. Ritacco, D. G. Lambright
Structural Basis Of Family-Wide Rab Gtpase Recognition By Rabenosyn-5.
Nature V. 436 415 2005
PubMed-ID: 16034420 | Reference-DOI: 10.1038/NATURE03798
(for further references see the PDB file header)

Molecule 1 - RAS-RELATED PROTEIN RAB-21
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX4T1
	Expression System Strain	:	BL21 (DE3) CODON PLUS-RIL CELLS
	Expression System Taxid	:	562
	Expression System Vector Type	:	GST FUSION, PGEX
	Fragment	:	GTPASE DOMAIN
	Gene	:	RAB21, KIAA0118
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:			C (1x)	D (1x)

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 12)

No.	Name	Count	Type	Full Name
1	GNP	4	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	8	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 5 (1, 1)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (12, 12)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	THR A:33 , THR A:51 , GNP A:1200 , HOH A:1307 , HOH A:1315	BINDING SITE FOR RESIDUE MG A 1300
02	AC2	SOFTWARE	THR B:33 , THR B:51 , GNP B:2200 , HOH B:2308 , HOH B:2309	BINDING SITE FOR RESIDUE MG B 2300
03	AC3	SOFTWARE	THR C:33 , GNP C:3200 , HOH C:5007 , HOH C:5009 , HOH C:5014	BINDING SITE FOR RESIDUE MG C 3300
04	AC4	SOFTWARE	THR D:33 , GNP D:4200 , HOH D:5011 , HOH D:5022 , HOH D:5032	BINDING SITE FOR RESIDUE MG D 4300
05	AC5	SOFTWARE	MET D:180 , THR D:183 , HOH D:5061 , HOH D:5093 , HOH D:5104 , HOH D:5110	BINDING SITE FOR RESIDUE MG D 5001
06	AC6	SOFTWARE	GLU D:79 , HOH D:5063 , HOH D:5064 , HOH D:5103 , HOH D:5128 , HOH D:5214	BINDING SITE FOR RESIDUE MG D 5002
07	AC7	SOFTWARE	HOH C:5042 , HOH C:5071 , HOH C:5078 , HOH D:5042 , HOH D:5045 , HOH D:5068	BINDING SITE FOR RESIDUE MG D 5003
08	AC8	SOFTWARE	GLU C:79 , HOH C:5041 , HOH C:5052 , HOH C:5070 , HOH C:5109 , HOH C:5185	BINDING SITE FOR RESIDUE MG C 5004
09	AC9	SOFTWARE	GLY A:28 , CYS A:29 , GLY A:31 , LYS A:32 , THR A:33 , SER A:34 , PHE A:44 , ASN A:45 , ASP A:46 , HIS A:48 , THR A:51 , GLY A:77 , ASN A:132 , LYS A:133 , ASP A:135 , LEU A:136 , SER A:162 , ALA A:163 , LYS A:164 , MG A:1300 , HOH A:1307 , HOH A:1315 , HOH A:1317 , HOH A:1319 , HOH A:1324 , HOH A:1329 , HOH A:1362 , HOH A:1442 , HOH A:1496 , HOH A:1517	BINDING SITE FOR RESIDUE GNP A 1200
10	BC1	SOFTWARE	GLU B:27 , GLY B:28 , CYS B:29 , GLY B:31 , LYS B:32 , THR B:33 , SER B:34 , PHE B:44 , ASN B:45 , ASP B:46 , HIS B:48 , THR B:50 , THR B:51 , GLY B:77 , ASN B:132 , LYS B:133 , ASP B:135 , LEU B:136 , SER B:162 , ALA B:163 , LYS B:164 , MG B:2300 , HOH B:2308 , HOH B:2309 , HOH B:2316 , HOH B:2319 , HOH B:2321 , HOH B:2338 , HOH B:2384 , HOH B:2397 , HOH B:2469	BINDING SITE FOR RESIDUE GNP B 2200
11	BC2	SOFTWARE	GLY C:28 , GLY C:31 , LYS C:32 , THR C:33 , SER C:34 , PHE C:44 , ASN C:45 , ASP C:46 , HIS C:48 , ALA C:76 , GLY C:77 , ASN C:132 , LYS C:133 , ASP C:135 , LEU C:136 , SER C:162 , ALA C:163 , LYS C:164 , MG C:3300 , HOH C:5007 , HOH C:5009 , HOH C:5014 , HOH C:5017 , HOH C:5021 , HOH C:5023 , HOH C:5041 , HOH C:5051 , HOH C:5070 , HOH C:5106 , HOH C:5169 , HOH C:5302	BINDING SITE FOR RESIDUE GNP C 3200
12	BC3	SOFTWARE	GLY D:28 , CYS D:29 , GLY D:31 , LYS D:32 , THR D:33 , SER D:34 , PHE D:44 , ASN D:45 , ASP D:46 , HIS D:48 , ALA D:76 , GLY D:77 , ASN D:132 , LYS D:133 , ASP D:135 , LEU D:136 , SER D:162 , ALA D:163 , LYS D:164 , MG D:4300 , HOH D:5011 , HOH D:5015 , HOH D:5022 , HOH D:5032 , HOH D:5034 , HOH D:5052 , HOH D:5063 , HOH D:5095 , HOH D:5100 , HOH D:5103 , HOH D:5109	BINDING SITE FOR RESIDUE GNP D 4200

(no "SS Bond" information available for 1Z08)

(no "Cis Peptide Bond" information available for 1Z08)

(no "SAP(SNP)/Variant" information available for 1Z08)

(no "PROSITE Motif" information available for 1Z08)

Asymmetric Unit (7, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000261263	1	ENSE00001194681	chr12:72148658-72149068	411	RAB21_HUMAN	1-53	53	4	A:17-53 B:17-53 C:17-53 D:18-53	37 37 37 36
1.2	ENST00000261263	2	ENSE00001098832	chr12:72163580-72163639	60	RAB21_HUMAN	54-73	20	4	A:54-73 B:54-73 C:54-73 D:54-73	20 20 20 20
1.3	ENST00000261263	3	ENSE00001098835	chr12:72164372-72164479	108	RAB21_HUMAN	74-109	36	4	A:74-109 (gaps) B:74-109 (gaps) C:74-109 D:74-109	36 36 36 36
1.4	ENST00000261263	4	ENSE00001098834	chr12:72167739-72167802	64	RAB21_HUMAN	110-131	22	4	A:110-131 B:110-131 C:110-131 D:110-131	22 22 22 22
1.5	ENST00000261263	5	ENSE00001098836	chr12:72175811-72175865	55	RAB21_HUMAN	131-149	19	4	A:131-149 B:131-149 C:131-149 D:131-149	19 19 19 19
1.6	ENST00000261263	6	ENSE00001098837	chr12:72176350-72176438	89	RAB21_HUMAN	149-179	31	4	A:149-179 B:149-179 C:149-179 D:149-179	31 31 31 31
1.7	ENST00000261263	7	ENSE00001431792	chr12:72179311-72181150	1840	RAB21_HUMAN	179-225	47	4	A:179-183 B:179-183 C:179-183 D:179-183	5 5 5 5

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:160
 aligned with RAB21_HUMAN | Q9UL25 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:167
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       
          RAB21_HUMAN    17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
               SCOP domains d1z08a1 A:17-183 Rab21                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....hhhhhhhhhhhh............eeeeeeee....eeeeeeee....-------........eeeeeee..hhhhhhhhhhhhhhhhhhhhhhheeeeeee.hhhhhhh..hhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:17-53 UniProt: 1-53 Exon 1.2            Exon 1.3  PDB: A:74-109 (gaps)      Exon 1.4              -----------------Exon 1.6  PDB: A:149-179       ---- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------Exon 1.5           -----------------------------1.7   Transcript 1 (2)
                 1z08 A  17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQ-------PIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
                                    26        36        46        56        66        76 |      86        96       106       116       126       136       146       156       166       176       
                                                                                        78      86

Chain B from PDB  Type:PROTEIN  Length:158
 aligned with RAB21_HUMAN | Q9UL25 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:167
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       
          RAB21_HUMAN    17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
               SCOP domains d1z08b_ B: automated matches                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....hhhhhhhhhhhh............eeeeeeeee..eeeeeeeee....---------......eeeeeee..hhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhh..hhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:17-53 UniProt: 1-53 Exon 1.2            Exon 1.3  PDB: B:74-109 (gaps)      Exon 1.4              -----------------Exon 1.6  PDB: B:149-179       ---- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------Exon 1.5           -----------------------------1.7   Transcript 1 (2)
                 1z08 B  17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQ---------YYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
                                    26        36        46        56        66        76 |       - |      96       106       116       126       136       146       156       166       176       
                                                                                        78        88

Chain C from PDB  Type:PROTEIN  Length:167
 aligned with RAB21_HUMAN | Q9UL25 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:167
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       
          RAB21_HUMAN    17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
               SCOP domains d1z08c_ C: automated matches                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee....hhhhhhhhhhhh............eeeeeeeee..eeeeeeeee..hhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhhhhheeeeeeehhhhhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:17-53 UniProt: 1-53 Exon 1.2            Exon 1.3  PDB: C:74-109             Exon 1.4              -----------------Exon 1.6  PDB: C:149-179       ---- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------Exon 1.5           -----------------------------1.7   Transcript 1 (2)
                 1z08 C  17 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176

Chain D from PDB  Type:PROTEIN  Length:166
 aligned with RAB21_HUMAN | Q9UL25 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:166
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177      
          RAB21_HUMAN    18 YSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
               SCOP domains d1z08d_ D: automated matches                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---Ras-1z08D01 D:21-182                                                                                                                                              - Pfam domains (1)
           Pfam domains (2) ---Ras-1z08D02 D:21-182                                                                                                                                              - Pfam domains (2)
           Pfam domains (3) ---Ras-1z08D03 D:21-182                                                                                                                                              - Pfam domains (3)
           Pfam domains (4) ---Ras-1z08D04 D:21-182                                                                                                                                              - Pfam domains (4)
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhh............eeeeeeeee..eeeeeeeee..hhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhhhhheeeeeeehhhhhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:18-53 UniProt: 1-53Exon 1.2            Exon 1.3  PDB: D:74-109             Exon 1.4              -----------------Exon 1.6  PDB: D:149-179       ---- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------Exon 1.5           -----------------------------1.7   Transcript 1 (2)
                 1z08 D  18 YSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET 183
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: automated matches (303)

Protein domain: automated matches (303)

Human (Homo sapiens) [TaxId: 9606] (86)

1a	d1z08b_	B:
1b	d1z08c_	C:
1c	d1z08d_	D:

Family: G proteins (693)

Protein domain: Rab21 (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d1z08a1

A:17-183

(no "CATH Domain" information available for 1Z08)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: Ras (176)

Homo sapiens (Human) (141)

1a	Ras-1z08D01	D:21-182
1b	Ras-1z08D02	D:21-182
1c	Ras-1z08D03	D:21-182
1d	Ras-1z08D04	D:21-182

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (RAB21_HUMAN | Q9UL25)

molecular function
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008089	anterograde axonal transport	The directed movement of organelles or molecules along microtubules from the cell body toward the cell periphery in nerve cell axons.
	GO:0050775	positive regulation of dendrite morphogenesis	Any process that activates or increases the frequency, rate or extent of dendrite morphogenesis.
	GO:2000643	positive regulation of early endosome to late endosome transport	Any process that activates or increases the frequency, rate or extent of early endosome to late endosome transport.
	GO:0048260	positive regulation of receptor-mediated endocytosis	Any process that activates or increases the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0030516	regulation of axon extension	Any process that modulates the rate, direction or extent of axon extension.
	GO:0017157	regulation of exocytosis	Any process that modulates the frequency, rate or extent of exocytosis.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0032580	Golgi cisterna membrane	The lipid bilayer surrounding any of the thin, flattened compartments that form the central portion of the Golgi complex.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:1904115	axon cytoplasm	Any cytoplasm that is part of a axon.
	GO:0032154	cleavage furrow	The cleavage furrow is a plasma membrane invagination at the cell division site. The cleavage furrow begins as a shallow groove and eventually deepens to divide the cytoplasm.
	GO:0098559	cytoplasmic side of early endosome membrane	The side (leaflet) of the early endosome membrane that faces the cytoplasm.
	GO:0009898	cytoplasmic side of plasma membrane	The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0030659	cytoplasmic vesicle membrane	The lipid bilayer surrounding a cytoplasmic vesicle.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005802	trans-Golgi network	The network of interconnected tubular and cisternal structures located within the Golgi apparatus on the side distal to the endoplasmic reticulum, from which secretory vesicles emerge. The trans-Golgi network is important in the later stages of protein secretion where it is thought to play a key role in the sorting and targeting of secreted proteins to the correct destination.
	GO:0012506	vesicle membrane	The lipid bilayer surrounding any membrane-bounded vesicle in the cell.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GNP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z08)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z08
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RAB21_HUMAN \| Q9UL25
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RAB21_HUMAN \| Q9UL25
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RAB21_HUMAN \| Q9UL25	:	1yzt 1yzu 1z0i 2ot3

(no "Related Entries Specified in the PDB File" available for 1Z08)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 12)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (33, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File