1YBY - JenaLib

Title :   CONSERVED HYPOTHETICAL PROTEIN CTH-95 FROM CLOSTRIDIUM THERMOCELLUM

Authors :   M. Zhao, W. Zhou, J. Chang, J. Habel, I. Kataeva, H. Xu, L. Chen, D. Lee, J. Nguyen, S. -H. Chang, P. Horanyi, Q. Florence, W. Tempel, D. Lin, H. Zhang, L. Ljundahl, Z. -J. Liu, J. Rose, B. -C. Wang, Southeast Collaboratory For Structural Genomics (Secsg)

Date :   21 Dec 04 (Deposition) - 01 Feb 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym./Biol. Unit : A,B

Keywords :   Conserved Hypothetical Protein, Clostridium Thermocellum, Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg, Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Zhao, W. Zhou, J. Chang, J. Habel, I. Kataeva, H. Xu, L. Chen, D. Lee, J. Nguyen, S. -H. Chang, P. Horanyi, Q. Florence, W. Tempel, D. Lin, H. Zhang, L. Ljundahl, Z. -J. Liu, J. Rose, B. -C. Wang
Conserved Hypothetical Protein Cth-95 From Clostridium Thermocellum
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 15)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:176
 aligned with EFP_CLOTH | A3DDQ3 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
            EFP_CLOTH     1 MISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGFKGDTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV 185
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -1ybyA01 A:2-63  [code=2.30.30  .30, no name defined]          ----------------------------------------------------------------1ybyA03 A       :128-185 Nucleic acid-binding proteins     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhh....eeee..eeeeeeeeeee..--...eeeeeeee.....eeeeee....ee.....eeeeeeeeeee..eeeee......eeeeehhhhh..........eeeeeee..eeeeee...eeeeeeee.-------.....eeeeee....eeeee.......eeeee....eeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------EFP  PDB: A:150-169 ---------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yby A   1 mISAGDFKNGVTFELDGQIFQVIEFQHVKP--GAAFVRTKLKNIVTGATIEKTFNPTDKmPKAHIERKDmQYLYNDGDLYYFmDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDT-------TATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYmERV 185
                            |       10        20        30  |     40        50        60        70        80  |     90       100       110       120       130     |   -   |   150       160       170       180 |   
                            |                           30 33                         60-MSE    70-MSE       83-MSE                                              136     144                                   182-MSE
                            1-MSE

Chain B from PDB  Type:PROTEIN  Length:178
 aligned with EFP_CLOTH | A3DDQ3 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
            EFP_CLOTH     1 MISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGFKGDTATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYMERV 185
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -1ybyB01 B:2-63  [code=2.30.30.30, no name defined]            ----------------------------------------------------------------1ybyB03 B:128       -185 Nucleic acid-binding proteins     CATH domains
           Pfam domains (1) --EFP_N-1ybyB01 B:3-60                                      ------EFP-1ybyB03 B:67-121                                   -------Elong-fact-P       _C-1ybyB05 B:129-184                 - Pfam domains (1)
           Pfam domains (2) --EFP_N-1ybyB02 B:3-60                                      ------EFP-1ybyB04 B:67-121                                   -------Elong-fact-P       _C-1ybyB06 B:129-184                 - Pfam domains (2)
         Sec.struct. author .ee.hhh....eee....eeeeeeeeee.......eeeeeeee.....eeeeee....ee.....eeeeeeeeeee..eeeee......eeeeehhhhh..........eeeeee....eeeee...eeeeeeeee....-------.eeeeee....eeeee.......eeeee....eeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------EFP  PDB: B:150-169 ---------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yby B   1 mISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDKmPKAHIERKDmQYLYNDGDLYYFmDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGF-------ATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEYmERV 185
                            |       10        20        30        40        50        60        70        80  |     90       100       110       120       130       140       150       160       170       180 |   
                            |                                                         60-MSE    70-MSE       83-MSE                                                  140     148                               182-MSE
                            1-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (3, 6)

Gene Ontology (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (EFP_CLOTH | A3DDQ3)

molecular function
	GO:0003746	translation elongation factor activity	Functions in chain elongation during polypeptide synthesis at the ribosome.
biological process
	GO:0043043	peptide biosynthetic process	The chemical reactions and pathways resulting in the formation of peptides, compounds of 2 or more (but usually less than 100) amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another. This may include the translation of a precursor protein and its subsequent processing into a functional peptide.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006414	translational elongation	The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yby)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1yby
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EFP_CLOTH \| A3DDQ3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description