|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 17)| Asymmetric Unit (2, 17) Biological Unit 1 (1, 13) Biological Unit 2 (1, 4) Biological Unit 3 (1, 4) Biological Unit 4 (1, 4) Biological Unit 5 (1, 9) |
Sites (17, 17)
Asymmetric Unit (17, 17)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XMA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XMA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XMA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XMA) |
Exons (0, 0)| (no "Exon" information available for 1XMA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:101 aligned with A3DGR1_CLOTH | A3DGR1 from UniProtKB/TrEMBL Length:114 Alignment length:103 13 23 33 43 53 63 73 83 93 103 A3DGR1_CLOTH 4 SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETQGKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK 106 SCOP domains d1xmaa_ A: Predicted transcriptional regulator SCOP domains CATH domains ------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1xma A 4 SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEET--KRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK 106 13 23 33 43 53 63 | 73 83 93 103 69 72 Chain B from PDB Type:PROTEIN Length:103 aligned with A3DGR1_CLOTH | A3DGR1 from UniProtKB/TrEMBL Length:114 Alignment length:106 10 20 30 40 50 60 70 80 90 100 A3DGR1_CLOTH 1 MISSDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETQGKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK 106 SCOP domains d1xmab_ B: Predicted transcriptional regulator SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) --------------PadR-1xmaB01 B:15-89 ----------------- Pfam domains (1) Pfam domains (2) --------------PadR-1xmaB02 B:15-89 ----------------- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1xma B 1 VISSDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEET---RRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK 106 10 20 30 40 50 60 |- | 80 90 100 69 73
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1XMA) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1XMA)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|