|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 19)
Asymmetric Unit (1, 19)
|
Sites (19, 19)
Asymmetric Unit (19, 19)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XEQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XEQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XEQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XEQ) |
Exons (0, 0)| (no "Exon" information available for 1XEQ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:89 aligned with NS1_INBLE | P03502 from UniProtKB/Swiss-Prot Length:281 Alignment length:89 24 34 44 54 64 74 84 94 NS1_INBLE 15 GATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY 103 SCOP domains d1xeqa1 A:15-103 N-terminal, RNA-binding domain of nonstructural protein NS1 SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1xeq A 15 GATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY 103 24 34 44 54 64 74 84 94 Chain B from PDB Type:PROTEIN Length:85 aligned with NS1_INBLE | P03502 from UniProtKB/Swiss-Prot Length:281 Alignment length:85 18 28 38 48 58 68 78 88 NS1_INBLE 9 QIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDP 93 SCOP domains d1xeqb_ B: N-terminal, RNA-binding domain of nonstructural protein NS1 SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains (1) Flu_B_NS1-1xeqB01 B:9-93 Pfam domains (1) Pfam domains (2) Flu_B_NS1-1xeqB02 B:9-93 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 1xeq B 9 QIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDP 93 18 28 38 48 58 68 78 88
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1XEQ) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (NS1_INBLE | P03502)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|