Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE CHEMOTAXIS INHIBITORY PROTEIN OF STAPHYLOCOCCUS AUREUS
 
Authors :  P. J. Haas, C. J. De Haas, M. J. Poppelier, K. P. Van Kessel, J. A. Van Strijp, K. Dijkstra, R. M. Scheek, H. Fan, J. A. Kruijtzer, R. M. Liskamp, J. Kemmink
Date :  10 Sep 04  (Deposition) - 27 Sep 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Chemotaxis Inhibitory Protein, Staphylococcus Aureus, Superantigen, C5A, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. J. Haas, C. J. De Haas, M. J. Poppelier, K. P. Van Kessel, J. A. Van Strijp, K. Dijkstra, R. M. Scheek, H. Fan, J. A. Kruijtzer, R. M. Liskamp, J. Kemmink
The Structure Of The C5A Receptor-Blocking Domain Of Chemotaxis Inhibitory Protein Of Staphylococcus Aureus Is Related To A Group Of Immune Evasive Molecules
J. Mol. Biol. V. 353 859 2005
PubMed-ID: 16213522  |  Reference-DOI: 10.1016/J.JMB.2005.09.014
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHEMOTAXIS-INHIBITING PROTEIN CHIPS
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPRSET
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentRESIDUES 31-121
    GeneCHP
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid1280

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XEE)

(-) Sites  (0, 0)

(no "Site" information available for 1XEE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XEE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XEE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XEE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XEE)

(-) Exons   (0, 0)

(no "Exon" information available for 1XEE)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with CHIPS_STAAE | A6QIG7 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:91
                                    68        78        88        98       108       118       128       138       148 
          CHIPS_STAAE    59 NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY 149
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains CHIPS-1xeeA01 A:31-121                                                                      Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh...hhh.eeeeeeee....eeeee.....hhhhhh......eeeeeeee.......eeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 1xee A  31 NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY 121
                                    40        50        60        70        80        90       100       110       120 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1XEE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1XEE)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (CHIPS_STAAE | A6QIG7)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xee)
 
  Sites
(no "Sites" information available for 1xee)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xee)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xee
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHIPS_STAAE | A6QIG7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CHIPS_STAAE | A6QIG7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHIPS_STAAE | A6QIG72k3u

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XEE)