1X6B - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURES OF THE SH3 DOMAIN OF HUMAN RHO GUANINE EXCHANGE FACTOR (GEF) 16

Authors :   M. Sato, K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   17 May 05 (Deposition) - 17 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Sh3 Domain, Neuroblastoma, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Sato, K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structures Of The Sh3 Domain Of Human Rho Guanine Exchange Factor (Gef) 16
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - RHO GUANINE EXCHANGE FACTOR (GEF) 16
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040816-12
	Expression System Vector Type	:	PLASMID
	Fragment	:	SH3 DOMAIN
	Gene	:	ARHGEF16
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1X6B)

(no "Site" information available for 1X6B)

(no "SS Bond" information available for 1X6B)

(no "Cis Peptide Bond" information available for 1X6B)

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061796	E	681	K	ARHGG_HUMAN	Polymorphism	56309807	A	E	67	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH3	PS50002	Src homology 3 (SH3) domain profile.	ARHGG_HUMAN	640-689	1	A:26-73

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000378378	1a	ENSE00001710589	chr1:3370990-3371375	386	ARHGG_HUMAN	-	0	0	-	-
1.2	ENST00000378378	2	ENSE00002146664	chr1:3379630-3380236	607	ARHGG_HUMAN	1-196	196	0	-	-
1.3b	ENST00000378378	3b	ENSE00001689961	chr1:3382712-3382757	46	ARHGG_HUMAN	197-212	16	0	-	-
1.4b	ENST00000378378	4b	ENSE00001713504	chr1:3383732-3383901	170	ARHGG_HUMAN	212-268	57	0	-	-
1.5b	ENST00000378378	5b	ENSE00001733234	chr1:3385444-3385500	57	ARHGG_HUMAN	269-287	19	0	-	-
1.6	ENST00000378378	6	ENSE00001661541	chr1:3385997-3386157	161	ARHGG_HUMAN	288-341	54	0	-	-
1.8b	ENST00000378378	8b	ENSE00000896165	chr1:3389642-3389794	153	ARHGG_HUMAN	341-392	52	0	-	-
1.9b	ENST00000378378	9b	ENSE00000896168	chr1:3389957-3390086	130	ARHGG_HUMAN	392-435	44	0	-	-
1.10	ENST00000378378	10	ENSE00000896171	chr1:3391272-3391346	75	ARHGG_HUMAN	436-460	25	0	-	-
1.11b	ENST00000378378	11b	ENSE00000896174	chr1:3392534-3392626	93	ARHGG_HUMAN	461-491	31	0	-	-
1.12a	ENST00000378378	12a	ENSE00000896177	chr1:3394439-3394590	152	ARHGG_HUMAN	492-542	51	0	-	-
1.12c	ENST00000378378	12c	ENSE00000896180	chr1:3394988-3395176	189	ARHGG_HUMAN	542-605	64	1	A:1-6 (gaps)	13
1.13	ENST00000378378	13	ENSE00000896183	chr1:3396081-3396154	74	ARHGG_HUMAN	605-630	26	1	A:6-16 (gaps)	26
1.14	ENST00000378378	14	ENSE00000896186	chr1:3396376-3396477	102	ARHGG_HUMAN	630-664	35	1	A:16-50	35
1.15b	ENST00000378378	15b	ENSE00001477264	chr1:3397012-3397677	666	ARHGG_HUMAN	664-709	46	1	A:50-79 (gaps)	32

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:79
 aligned with ARHGG_HUMAN | Q5VV41 from UniProtKB/Swiss-Prot  Length:709

    Alignment length:103
                                   602       612       622       632       642       652       662       672       682       692   
          ARHGG_HUMAN   593 GRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEG 695
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------1x6bA01 A:16-79 SH3 Domains                                        CATH domains
               Pfam domains ---------------------------------------------SH3_1-1x6bA01 A:24-67                       -------------- Pfam domains
         Sec.struct. author .-------......---------------...........eeee.................eeeeeeeee..eeeeee.....eeeehhhhheeee.--.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------K-------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------SH3  PDB: A:26-73 UniProt: 640-689                ------ PROSITE
           Transcript 1 (1) Exon 1.12c   ------------------------Exon 1.14  PDB: A:16-50            ------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.13 UniProt: 605-630---------------------------------Exon 1.15b  PDB: A:50-79 (gaps)  Transcript 1 (2)
                 1x6b A   1 G-------SSGSSG---------------WQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFISG--PSSG  79
                            |       |3   |     -         8        18        28        38        48        58        68      | 76   
                            |       2    7               8                                                                 75 76   
                            1

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1X6B)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: SH3 type barrels. (648)

Homologous Superfamily: SH3 Domains (267)

Human (Homo sapiens) (133)

1x6bA01

A:16-79

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: SH3 (175)

Family: SH3_1 (141)

Homo sapiens (Human) (69)

SH3_1-1x6bA01

A:24-67

NMR Structure(hide GO term definitions)

Chain A (ARHGG_HUMAN | Q5VV41)

molecular function
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0017048	Rho GTPase binding	Interacting selectively and non-covalently with Rho protein, any member of the Rho subfamily of the Ras superfamily of monomeric GTPases. Proteins in the Rho subfamily are involved in relaying signals from cell-surface receptors to the actin cytoskeleton.
	GO:0005089	Rho guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005085	guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030971	receptor tyrosine kinase binding	Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
biological process
	GO:0090630	activation of GTPase activity	Any process that initiates the activity of an inactive GTPase through the replacement of GDP by GTP.
	GO:0060326	cell chemotaxis	The directed movement of a motile cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0090004	positive regulation of establishment of protein localization to plasma membrane	Any process that increases the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x6b)

	Sites
(no "Sites" information available for 1x6b)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x6b)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1x6b
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARHGG_HUMAN \| Q5VV41
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARHGG_HUMAN \| Q5VV41
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1X6B)

(no "Related Entries Specified in the PDB File" available for 1X6B)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File