|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 4) |
Asymmetric Unit (4, 4)
|
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 1WUW) |
(no "SAP(SNP)/Variant" information available for 1WUW) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1WUW) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:45 aligned with THNB_HORVU | P21742 from UniProtKB/Swiss-Prot Length:136 Alignment length:45 37 47 57 67 THNB_HORVU 28 KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK 72 SCOP domains d1wuwa_ A: Hordothionin SCOP domains CATH domains 1wuwA00 A:1-45 CATH domains Pfam domains --------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------- SAPs(SNPs) PROSITE --THIONIN ----------------------------- PROSITE Transcript --------------------------------------------- Transcript 1wuw A 1 KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK 45 10 20 30 40 Chain B from PDB Type:PROTEIN Length:45 aligned with THNB_HORVU | P21742 from UniProtKB/Swiss-Prot Length:136 Alignment length:45 37 47 57 67 THNB_HORVU 28 KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK 72 SCOP domains d1wuwb_ B: Hordothionin SCOP domains CATH domains 1wuwB00 B:51-95 CATH domains Pfam domains (1) Thionin-1wuwB01 B:51-95 Pfam domains (1) Pfam domains (2) Thionin-1wuwB02 B:51-95 Pfam domains (2) SAPs(SNPs) --------------------------------------------- SAPs(SNPs) PROSITE --THIONIN ----------------------------- PROSITE Transcript --------------------------------------------- Transcript 1wuw B 51 KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK 95 60 70 80 90
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (THNB_HORVU | P21742)
|
|
|
|
|
|
|