Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN GI:29375081, UNKNOWN MEMBER OF ENOLASE SUPERFAMILY FROM ENTEROCOCCUS FAECALIS V583
 
Authors :  A. A. Fedorov, E. V. Fedorov, W. S. Yew, J. A. Gerlt, S. C. Almo, S. K. Burle York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  05 Dec 04  (Deposition) - 21 Dec 04  (Release) - 24 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Unknown Function, Nysgxrc Target T2185, Enolase Superfamily, New York Sgx Research Center For Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Odokonyero, A. Sakai, Y. Patskovsky, V. N. Malashkevich, A. A. Fedorov, J. B. Bonanno, E. V. Fedorov, R. Toro, R. Agarwal, C. Wang N. D. Ozerova, W. S. Yew, J. M. Sauder, S. Swaminathan, S. K. Burley, S. C. Almo, M. E. Glasner
Loss Of Quaternary Structure Is Associated With Rapid Sequence Divergence In The Osbs Family
Proc. Natl. Acad. Sci. Usa V. 111 8535 2014
PubMed-ID: 24872444  |  Reference-DOI: 10.1073/PNAS.1318703111

(-) Compounds

Molecule 1 - MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME FAMILY PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentRESIDUES 20-367(DATABASE SEQUENCE)
    Organism ScientificENTEROCOCCUS FAECALIS
    Organism Taxid226185
    StrainV583

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WUE)

(-) Sites  (0, 0)

(no "Site" information available for 1WUE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1WUE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WUE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WUE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1WUE)

(-) Exons   (0, 0)

(no "Exon" information available for 1WUE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:370
 aligned with Q838J7_ENTFA | Q838J7 from UniProtKB/TrEMBL  Length:367

    Alignment length:370
                               1                                                                                                                                                                                                                                                                                                                                                                              
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367
        Q838J7_ENTFA      - ---MNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM  367
               SCOP domains ---d1wuea2 A:1001-1126 N-acylamino acid racemase                                                                                 d1wuea1 A:1127-1367 N-acylamino acid racemase                                                                                                                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------1wueA02 A:1125-1332,A:1333-1344 Enolase superfamily                                                                                                                                                             1wueA02     ----------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeee....eeeeee...........hhhhhhhhhhhhhhhhhh.......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhh.....eee..eee....hhhhhhhhhhhhhhh....eeee.....hhhhhhhhhhhh....eeee.....hhhhhhhhhhhhhh....ee.......hhhhhhhhh.....eee.....hhhhhhhhhhhh...eeeehhhhhhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh...........hhhhh...........ee..eee...........hhhhhhhheeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1wue A  998 GSHMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM 1367
                                  1007      1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237      1247      1257      1267      1277      1287      1297      1307      1317      1327      1337      1347      1357      1367

Chain B from PDB  Type:PROTEIN  Length:369
 aligned with Q838J7_ENTFA | Q838J7 from UniProtKB/TrEMBL  Length:367

    Alignment length:369
                              1                                                                                                                                                                                                                                                                                                                                                                              
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358         
        Q838J7_ENTFA      - --MNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM  367
               SCOP domains --d1wueb2 B:2001-2126 N-acylamino acid racemase                                                                                 d1wueb1 B:2127-2367 N-acylamino acid racemase                                                                                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------1wueB02 B:2125-2332,B:2333-2344 Enolase superfamily                                                                                                                                                             1wueB02     ----------------------- CATH domains
           Pfam domains (1) ----MR_MLE_N-1wueB01 B:2003-2125                                                                                               -----------------------------------------------------------------------------------------------------------------MR_MLE_C-1wueB03 B:2239-2351                                                                                     ---------------- Pfam domains (1)
           Pfam domains (2) ----MR_MLE_N-1wueB02 B:2003-2125                                                                                               -----------------------------------------------------------------------------------------------------------------MR_MLE_C-1wueB04 B:2239-2351                                                                                     ---------------- Pfam domains (2)
         Sec.struct. author ....eeeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeee....eeeeee...........hhhhhhhhhhhhhhhhhh.......hhhhhhhh....hhhhhhhhhhhhhhhhhhhh..hhhhhh.....eee..eee....hhhhhhhhhhhhhhh....eeee.....hhhhhhhhhhhh....eeee.....hhhhhhhhhhhhhhh..eee.......hhhhhhhhhhh..eeee.....hhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh...........hhhhh...........ee..eee...........hhhhhhhheeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1wue B 1999 SHMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM 2367
                                  2008      2018      2028      2038      2048      2058      2068      2078      2088      2098      2108      2118      2128      2138      2148      2158      2168      2178      2188      2198      2208      2218      2228      2238      2248      2258      2268      2278      2288      2298      2308      2318      2328      2338      2348      2358         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q838J7_ENTFA | Q838J7)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016836    hydro-lyase activity    Catalysis of the cleavage of a carbon-oxygen bond by elimination of water.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0009234    menaquinone biosynthetic process    The chemical reactions and pathways resulting in the formation of any of the menaquinones. Structurally, menaquinones consist of a methylated naphthoquinone ring structure and side chains composed of a variable number of unsaturated isoprenoid residues. Menaquinones that have vitamin K activity and are known as vitamin K2.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wue)
 
  Sites
(no "Sites" information available for 1wue)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wue)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wue
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q838J7_ENTFA | Q838J7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q838J7_ENTFA | Q838J7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1WUE)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WUE)