![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1WIJ) |
(no "Site" information available for 1WIJ) |
(no "SS Bond" information available for 1WIJ) |
NMR Structure
|
(no "SAP(SNP)/Variant" information available for 1WIJ) |
(no "PROSITE Motif" information available for 1WIJ) |
(no "Exon" information available for 1WIJ) |
NMR StructureChain A from PDB Type:PROTEIN Length:127 aligned with EIL3_ARATH | O23116 from UniProtKB/Swiss-Prot Length:567 Alignment length:127 171 181 191 201 211 221 231 241 251 261 271 281 EIL3_ARATH 162 SQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQSPPYRKPHDLKKMWKVGVLTAVINHMLPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQ 288 SCOP domains d1wija_ A: Ethylene insensitive 3 (EIN3)-like protein 3, EIL3 SCOP domains CATH domains 1wijA00 A:162-288 DNA-binding domain of ethylene- insensitive3-like3 CATH domains Pfam domains EIN3-1wijA01 A:162-288 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1wij A 162 SQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQSPPYRKPHDLKKMWKVGVLTAVINHMLPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQ 288 171 181 191 201 211 221 231 241 251 261 271 281
|
NMR Structure |
NMR Structure |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A (EIL3_ARATH | O23116)
|
|
|
|
|
|
|