|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WII) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WII) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WII) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WII) |
Exons (0, 0)| (no "Exon" information available for 1WII) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:85 aligned with ELOF1_MOUSE | P60003 from UniProtKB/Swiss-Prot Length:83 Alignment length:85 83 10 20 30 40 50 60 70 80 | ELOF1_MOUSE 1 MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ-- - SCOP domains d1wiia_ A: Hypothetical UPF0222 protein MGC4549 SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains -------Elf1-1wiiA01 A:8-79 ------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 1wii A 1 GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG 85 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WII) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (ELOF1_MOUSE | P60003)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|