Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE FIRST SH3 DOMAIN OF KIAA0318 PROTEIN
 
Authors :  K. Inoue, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  28 May 04  (Deposition) - 28 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Beta Barrel, Rim-Binding Protein 2, Kiaa0318 Protein, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Inoue, F. Hayashi, S. Yokoyama
Solution Structure Of The First Sh3 Domain Of Kiaa0318 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIM BINDING PROTEIN 2
    Chains: A
    Engineered: YES
    Expression System Plasmid: P030512-61
    Expression System Vector Type: PLASMID
    Fragment: SH3 DOMAIN
    Gene: KAZUSA CDNA HG00364
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: CELL-FREE PROTEIN SYNTHESIS
    Synonym: KIAA0318 PROTEIN, RIM-BP2

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WIE)

(-) Sites  (0, 0)

(no "Site" information available for 1WIE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1WIE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WIE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WIE)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.RIMB2_HUMAN167-234
848-916
952-1019		  1A:15-82
-
-

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002616551ENSE00001225399chr12:131002410-13100237338RIMB2_HUMAN-00--
1.2ENST000002616552ENSE00001121163chr12:130991315-130991193123RIMB2_HUMAN-00--
1.3ENST000002616553ENSE00002176189chr12:130963561-130963457105RIMB2_HUMAN1-34340--
1.4ENST000002616554ENSE00001656454chr12:130941245-130941041205RIMB2_HUMAN35-103690--
1.5ENST000002616555ENSE00000757527chr12:130935885-130935740146RIMB2_HUMAN103-151491A:1-5 (gaps)34
1.6ENST000002616556ENSE00000938260chr12:130934821-13093474577RIMB2_HUMAN152-177261A:6-2520
1.7ENST000002616557ENSE00000938261chr12:130929814-130929705110RIMB2_HUMAN177-214381A:25-6238
1.8ENST000002616558ENSE00000757523chr12:130927205-130926393813RIMB2_HUMAN214-4852721A:62-96 (gaps)70
1.9ENST000002616559ENSE00000757521chr12:130923061-130922910152RIMB2_HUMAN485-535510--
1.10ENST0000026165510ENSE00000757520chr12:130921836-130921387450RIMB2_HUMAN536-6851500--
1.11ENST0000026165511ENSE00000757519chr12:130919425-130919279147RIMB2_HUMAN686-734490--
1.13ENST0000026165513ENSE00000757518chr12:130912882-130912724159RIMB2_HUMAN735-787530--
1.14ENST0000026165514ENSE00000757517chr12:130907106-130906998109RIMB2_HUMAN788-824370--
1.15ENST0000026165515ENSE00000757516chr12:130898851-130898670182RIMB2_HUMAN824-884610--
1.16ENST0000026165516ENSE00000903693chr12:130897332-130897164169RIMB2_HUMAN885-941570--
1.17ENST0000026165517ENSE00000903691chr12:130892374-130892271104RIMB2_HUMAN941-975350--
1.18ENST0000026165518ENSE00000757511chr12:130890788-13089071772RIMB2_HUMAN976-999240--
1.19ENST0000026165519ENSE00000903689chr12:130884358-130884224135RIMB2_HUMAN1000-1044450--
1.20ENST0000026165520ENSE00001425478chr12:130883706-1308806823025RIMB2_HUMAN1045-105280--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:96
 aligned with RIMB2_HUMAN | O15034 from UniProtKB/Swiss-Prot  Length:1052

    Alignment length:174
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279    
          RIMB2_HUMAN   110 GSSAIGEYIRPLPQPGDRPEPLSAKPTFLSRSGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDNSAG 283
               SCOP domains d1                             wie              a_ A: RIM binding protein 2, RIMBP2                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains --------------------------------------------------------------SH3_2-1wieA01 A:20-80                                        --------------------------------------------------- Pfam domains
         Sec.struct. author ..-----------------------------...--------------...........eeeeee....hhhhh...............eeeee.........eeee............ee..............-------------------------.----------... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------SH3  PDB: A:15-82 UniProt: 167-234                                  ------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:1-5 (gaps) [INCOMPLETE]  Exon 1.6  PDB: A:6-25     ------------------------------------Exon 1.8  PDB: A:62-96 (gaps) UniProt: 214-485 [INCOMPLETE]            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------Exon 1.7  PDB: A:25-62                --------------------------------------------------------------------- Transcript 1 (2)
                 1wie A   1 GS-----------------------------SGS--------------SGTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTSG-------------------------P----------SSG  96
                             |       -         -         - | |     -        |7        17        27        37        47        57        67        77        87    |    -         -         -|        - |  
                             2                             3 5              6                                                                                    92                        93         94
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1WIE)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: SH3 (175)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (RIMB2_HUMAN | O15034)
biological process
    GO:0010923    negative regulation of phosphatase activity    Any process that decreases the rate or frequency of phosphatase activity. Phosphatases catalyze the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
cellular component
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wie)
 
  Sites
(no "Sites" information available for 1wie)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wie)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wie
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RIMB2_HUMAN | O15034
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RIMB2_HUMAN | O15034
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RIMB2_HUMAN | O15034: 2csi 2csp 2csq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WIE)