|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WGE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WGE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WGE) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WGE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:83 aligned with DPH3_MOUSE | Q8K0W9 from UniProtKB/Swiss-Prot Length:82 Alignment length:83 1 | 3 13 23 33 43 53 63 73 DPH3_MOUSE - -------MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETVPAPSTN 76 SCOP domains -------d1wgea1 A:8-77 DelGEF-interacting protein 1, DelGIP1 ------ SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains ------------zf-CSL-1wgeA01 A:13-67 ---------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------ZF_DPH PDB: A:11-67 UniProt: 4-60 ---------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 1wge A 1 GSSGSSGMAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETVSGPSSG 83 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WGE) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (DPH3_MOUSE | Q8K0W9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|