|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WG2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WG2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WG2) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WG2) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:64 aligned with SAP7_ARATH | Q9SZ69 from UniProtKB/Swiss-Prot Length:175 Alignment length:167 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 SAP7_ARATH 2 GSEENNSTSFPPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLKLPSCSIIAPGQKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVK 168 SCOP domains d1w g2a_ A: SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------zf-AN1-1wg2A01 A:18-58 ------------ Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------ZF_A20 PDB: A:4-5 UniProt: 13-47 -----------------------------------------------------------------ZF_AN1 PDB: A:15-58 UniProt: 113-156 ------------ PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1wg2 A 1 GSS----------------------GSSG---------------------------------------------------------------------------PSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVG------SGPSSG 64 | - - | |- - - - - - - - | 13 23 33 43 53 | - | 3 4 7 8 58 59
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WG2) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (SAP7_ARATH | Q9SZ69)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|