|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 9)
Asymmetric Unit (3, 9)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WFX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WFX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WFX) |
Exons (0, 0)| (no "Exon" information available for 1WFX) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:180 aligned with KPTA_AERPE | Q9YFP5 from UniProtKB/Swiss-Prot Length:220 Alignment length:180 46 56 66 76 86 96 106 116 126 136 146 156 166 176 186 196 206 216 KPTA_AERPE 37 VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL 216 SCOP domains d1wfxa_ A: Probable RNA 2'-phosphotransferase KptA SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains PTS_2-RNA-1wfxA01 A:3-169 ------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1wfx A 3 VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLImERGImRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERmSKTVYTVDWVPPECIAEVRRESL 182 12 22 32 42 52 62 72 82 92 102 | 112 122 132 142 152 |162 172 182 107-MSE| 159-MSE 112-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WFX) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (KPTA_AERPE | Q9YFP5)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|