|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WFP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WFP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WFP) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WFP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:74 aligned with SAP1_ARATH | Q6NNI8 from UniProtKB/Swiss-Prot Length:168 Alignment length:75 90 100 110 120 130 140 150 SAP1_ARATH 81 GSGSSSSSTRGGDSAAAPLDPPKSTATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAK 155 SCOP domains d1 wfpa_ A: Zinc finger A20 and AN1 domains containing protein At1g12440 SCOP domains CATH domains --------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------zf-AN1-1wfpA01 A:28-68 ------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------ZF_AN1 PDB: A:25-68 UniProt: 106-149 ------ PROSITE Transcript --------------------------------------------------------------------------- Transcript 1wfp A 1 GS-SGSSGTRGGDSAAAPLDPPKSTATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVASGPSSG 74 | | 9 19 29 39 49 59 69 2 3
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WFP) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (SAP1_ARATH | Q6NNI8)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|