|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WFH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WFH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WFH) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WFH) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:64 aligned with SAP4_ARATH | Q9SJM6 from UniProtKB/Swiss-Prot Length:161 Alignment length:134 33 43 53 63 73 83 93 103 113 123 133 143 153 SAP4_ARATH 24 GSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTEQPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAK 157 SCOP domains d1wfha _ A: SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------zf-AN1-1wfhA01 A:18-58 --------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------ZF_AN1 PDB: A:15-58 UniProt: 99-142 --------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1wfh A 1 GSSGSS-------G------------------------------------------------------QPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAG------SGP---SSG 64 | - | - - - - - |9 19 29 39 49 |- | | - | 6 7 8 58 59 | 62 61
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WFH) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (SAP4_ARATH | Q9SJM6)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|