Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF VANABIN2 (RUH-017), A VANADIUM-BINDING PROTEIN FROM ASCIDIA SYDNEIENSIS SAMEA
 
Authors :  T. Hamada, H. Hirota, M. Asanuma, F. Hayashi, N. Kobayashi, T. Ueki, H. Michibata, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  13 Apr 04  (Deposition) - 22 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nmr, Vanadium-Binding, Ascidian, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Hamada, M. Asanuma, T. Ueki, F. Hayashi, N. Kobayashi, S. Yokoyama, H. Michibata, H. Hirota
Solution Structure Of Vanabin2, A Vanadium(Iv)-Binding Protein From The Vanadium-Rich Ascidian Ascidia Sydneiensis Samea
J. Am. Chem. Soc. V. 127 4216 2005
PubMed-ID: 15783203  |  Reference-DOI: 10.1021/JA042687J
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VANADIUM-BINDING PROTEIN 2
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPMAL-C
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentRESIDUES 1-95
    Organism ScientificASCIDIA SYDNEIENSIS SAMEA
    Organism Taxid79730
    StrainSAMEA
    SynonymVANABIN2, RUH-017

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1VFI)

(-) Sites  (0, 0)

(no "Site" information available for 1VFI)

(-) SS Bonds  (9, 9)

NMR Structure
No.Residues
1A:9 -A:63
2A:13 -A:59
3A:17 -A:56
4A:23 -A:49
5A:27 -A:44
6A:31 -A:40
7A:67 -A:94
8A:72 -A:89
9A:76 -A:86

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VFI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VFI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VFI)

(-) Exons   (0, 0)

(no "Exon" information available for 1VFI)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with VBP2_ASCSS | Q86BW2 from UniProtKB/Swiss-Prot  Length:120

    Alignment length:103
                                    27        37        47        57        67        77        87        97       107       117   
           VBP2_ASCSS    18 INATYVEFEEAYAPVDCKGQCTTPCEPLTACKEKCAESCETSADKKTCRRNCKKADCEPQDKVCDACRMKCHKACRAANCASECPKHEHKSDTCRACMKTNCK 120
               SCOP domains -----------d1vfia1 A:4-95 Vanadium-binding protein 2, vanabin 2                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------Vanabin-2-1vfiA01 A:9-94                                                              - Pfam domains
         Sec.struct. author ..--------..............hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1vfi A   1 IS--------EFAPVDCKGQCTTPCEPLTACKEKCAESCETSADKKTCRRNCKKADCEPQDKVCDACRMKCHKACRAANCASECPKHEHKSDTCRACMKTNCK  95
                             |       -|       12        22        32        42        52        62        72        82        92   
                             2        3                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1VFI)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (VBP2_ASCSS | Q86BW2)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1vfi)
 
  Sites
(no "Sites" information available for 1vfi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vfi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vfi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VBP2_ASCSS | Q86BW2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VBP2_ASCSS | Q86BW2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1VFI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VFI)