Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RSGI RUH-012, A UBA DOMAIN FROM MOUSE CDNA
 
Authors :  T. Abe, H. Hirota, K. Izumi, M. Yoshida, T. Yamazaki, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  31 Mar 04  (Deposition) - 30 Sep 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Ubiquitin Associated Domain, Uba Domain, Three Helix Bundle, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Abe, H. Hirota, K. Izumi, M. Yoshida, T. Yamazaki, S. Yokoyama
Solution Structure Of Rsgi Ruh-012, A Uba Domain From Mouse Cdna
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NEDD8 ULTIMATE BUSTER-1
    ChainsA
    EngineeredYES
    Expression System PlasmidP030324-39
    Expression System Vector TypePLASMID
    FragmentUBA DOMAIN
    GeneMUS MUSCULUS ADULT MALE MEDULLA OBLONGATA CDNA,
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsCELL-FREE PROTEIN SYNTHESIS SYSTEM
    ProductNY-REN-18 ANTIGEN, FULL INSERT SEQUENCE
    Riken Full-length Enriched Library, Clone6330412F12
    SynonymNY-REN-18 ANTIGEN, NUB1, BS4 PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1VEG)

(-) Sites  (0, 0)

(no "Site" information available for 1VEG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VEG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VEG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VEG)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBAPS50030 Ubiquitin-associated domain (UBA) profile.NUB1_MOUSE373-413
423-469
488-528
  1-
-
A:27-67

(-) Exons   (0, 0)

(no "Exon" information available for 1VEG)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:83
 aligned with NUB1_MOUSE | P54729 from UniProtKB/Swiss-Prot  Length:614

    Alignment length:109
                                   451       461       471       481       491       501       511       521       531       541         
           NUB1_MOUSE   442 GYSTQAAKQALHQARGNLDDALKVLLSNPHMWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGEDSSPTPSTS 550
               SCOP domains d1vega_                     A: NEDD8 ultimate buster-1 (Nub1)                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------------------------UBA-1vegA01 A:28-64                  ------------------------- Pfam domains
         Sec.struct. author .......--------------------.....................hhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhh...........------.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBA  PDB: - UniProt: 423-469------------------UBA  PDB: A:27-67 UniProt: 488-528       ---------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1veg A   1 GSSGSSG--------------------NPHMWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSG------PSSG  83
                                  |  -         -       |10        20        30        40        50        60        70        |-     |   
                                  7                    8                                                                     79     80   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1VEG)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: UBA (32)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (NUB1_MOUSE | P54729)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0032436    positive regulation of proteasomal ubiquitin-dependent protein catabolic process    Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1veg)
 
  Sites
(no "Sites" information available for 1veg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1veg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1veg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NUB1_MOUSE | P54729
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NUB1_MOUSE | P54729
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1VEG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VEG)