Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ATOMIC RESOLUTION STRUCTURE OF ATRATOXIN-B, ONE SHORT-CHAIN NEUROTOXIN FROM NAJA ATRA
 
Authors :  X. Lou, Q. Liu, M. Teng, L. Niu, Q. Huang, Q. Hao
Date :  20 Feb 04  (Deposition) - 21 Dec 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.92
Chains :  Asym./Biol. Unit :  A
Keywords :  Short-Chain Neurotoxin, Three-Finger Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Lou, Q. Liu, X. Tu, J. Wang, M. Teng, L. Niu, D. J. Schuller, Q. Huang, Q. Hao
The Atomic Resolution Crystal Structure Of Atratoxin Determined By Single Wavelength Anomalous Diffraction Phasing
J. Biol. Chem. V. 279 39094 2004
PubMed-ID: 15252034  |  Reference-DOI: 10.1074/JBC.M403863200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COBROTOXIN B
    ChainsA
    Organism CommonCHINESE COBRA
    Organism ScientificNAJA ATRA
    Organism Taxid8656
    SynonymCBT B, SHORT NEUROTOXIN, ATRATOXIN-B

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION
2TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:7 , ASP A:30 , HIS A:31 , LYS A:44 , HOH A:1035 , HOH A:1051 , HOH A:1059 , HOH A:1090 , HOH A:1091BINDING SITE FOR RESIDUE SO4 A 101
2AC2SOFTWARETHR A:16 , TRP A:28 , SER A:29 , ASN A:50 , THR A:55 , HOH A:1026 , HOH A:1079 , HOH A:1080 , HOH A:1111 , HOH A:1117BINDING SITE FOR RESIDUE TRS A 201

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:3 -A:23
2A:17 -A:40
3A:42 -A:53
4A:54 -A:59

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VB0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VB0)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3S1CC_NAJAT60-78  1A:39-57

(-) Exons   (0, 0)

(no "Exon" information available for 1VB0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:61
 aligned with 3S1CC_NAJAT | P80958 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:61
                                    31        41        51        61        71        81 
           3S1CC_NAJAT   22 LECHNQQSSQTPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCTTDRCNN 82
               SCOP domains d1vb0a_ A: Neurotoxin II (Nt2, cobrotoxin B)                  SCOP domains
               CATH domains 1vb0A00 A:1-61 CD59                                           CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee......eeeeeeee..eeeeeeee.........eeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------SNAKE_TOXIN        ---- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                  1vb0 A  1 LECHNQQSSQTPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCTTDRCNN 61
                                    10        20        30        40        50        60 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1VB0)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (3S1CC_NAJAT | P80958)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0035792    other organism postsynaptic membrane    A postsynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A postsynaptic membrane is a specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters transmit the signal across the synaptic cleft to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vb0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vb0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3S1CC_NAJAT | P80958
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  3S1CC_NAJAT | P80958
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        3S1CC_NAJAT | P809581onj 1y5s 1y5t

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VB0)