Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF EMS16-ALPHA2-I DOMAIN COMPLEX
 
Authors :  K. Horii, D. Okuda, T. Morita, H. Mizuno
Date :  19 Dec 03  (Deposition) - 07 Sep 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Snake Venom, C-Type Lectin, Antagonist, Integrin, Cell Adhesion, Glycoprotein, Toxin-Cell Adhesion Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Horii, D. Okuda, T. Morita, H. Mizuno
Crystal Structure Of Ems16 In Complex With The Integrin Alpha2-I Domain
J. Mol. Biol. V. 341 519 2004
PubMed-ID: 15276841  |  Reference-DOI: 10.1016/J.JMB.2004.06.036
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EMS16 A CHAIN
    ChainsA
    FragmentRESIDUES 1-134
    Organism ScientificECHIS MULTISQUAMATUS
    Organism Taxid93050
    SynonymEMS16 SUBUNIT A
 
Molecule 2 - EMS16 B CHAIN
    ChainsB
    FragmentRESIDUES 1-128
    MutationYES
    Organism ScientificECHIS MULTISQUAMATUS
    Organism Taxid93050
    SynonymEMS16 SUBUNIT B
 
Molecule 3 - INTEGRIN ALPHA-2
    ChainsC
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET32A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLAMID
    FragmentRESIDUES 138-337
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymALPHA2-I, PLATELET MEMBRANE GLYCOPROTEIN IA, GPIA, COLLAGEN RECEPTOR, VLA-2 ALPHA CHAIN, CD49B

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric/Biological Unit (4, 4)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2MN1Ligand/IonMANGANESE (II) ION
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4PO41Ligand/IonPHOSPHATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN B:21 , GLU B:24 , HOH B:1040 , GLU C:323BINDING SITE FOR RESIDUE NAG B 1022
2AC2SOFTWAREARG A:30 , GLU A:34 , HOH A:1597 , HOH A:1640 , HOH A:1646 , HIS B:11 , HOH B:1065 , HOH B:1121BINDING SITE FOR RESIDUE PO4 A 1501
3AC3SOFTWARESER C:153 , SER C:155 , ASP C:254 , HOH C:1501 , HOH C:1502 , HOH C:1503BINDING SITE FOR RESIDUE MN C 1500
4AC4SOFTWARETRP A:25 , ARG A:73 , HOH A:1521BINDING SITE FOR RESIDUE CL A 1502

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:4 -A:15
2A:32 -A:129
3A:81 -B:74
4A:104 -A:121
5B:1 -B:12
6B:29 -B:120
7B:95 -B:112

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Tyr C:157 -Pro C:158
2Ile C:306 -Pro C:307

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V7P)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.SLA_ECHML34-153  1A:11-130
SLB_ECHML34-147  1B:8-121
2VWFAPS50234 VWFA domain profile.ITA2_HUMAN174-361  1C:145-332

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002965851aENSE00002047974chr5:52285156-52285362207ITA2_HUMAN1-22220--
1.2ENST000002965852ENSE00001082059chr5:52322578-52322698121ITA2_HUMAN22-62410--
1.3ENST000002965853ENSE00001082086chr5:52337942-52338051110ITA2_HUMAN62-99380--
1.4ENST000002965854ENSE00001082085chr5:52340831-5234092292ITA2_HUMAN99-129310--
1.5ENST000002965855ENSE00001082071chr5:52344193-52344307115ITA2_HUMAN130-168390--
1.6ENST000002965856ENSE00001082076chr5:52344473-52344600128ITA2_HUMAN168-210431C:143-18139
1.7ENST000002965857ENSE00001082063chr5:52347241-52347389149ITA2_HUMAN211-260501C:182-23150
1.8ENST000002965858ENSE00001082075chr5:52351368-52351518151ITA2_HUMAN260-310511C:231-28151
1.9ENST000002965859ENSE00001082081chr5:52351814-52351979166ITA2_HUMAN311-366561C:282-33554
1.10ENST0000029658510ENSE00001082065chr5:52353855-5235393177ITA2_HUMAN366-391260--
1.11ENST0000029658511ENSE00001082067chr5:52355704-52355842139ITA2_HUMAN392-438470--
1.12ENST0000029658512ENSE00001082084chr5:52356731-52356876146ITA2_HUMAN438-486490--
1.13ENST0000029658513ENSE00001082064chr5:52358616-52358759144ITA2_HUMAN487-534480--
1.14ENST0000029658514ENSE00001082077chr5:52360742-52360945204ITA2_HUMAN535-602680--
1.15bENST0000029658515bENSE00001082062chr5:52361671-52361807137ITA2_HUMAN603-648460--
1.16ENST0000029658516ENSE00001082058chr5:52362948-52363087140ITA2_HUMAN648-695480--
1.17ENST0000029658517ENSE00001082055chr5:52365939-52366090152ITA2_HUMAN695-745510--
1.18ENST0000029658518ENSE00001082082chr5:52367768-52367878111ITA2_HUMAN746-782370--
1.19ENST0000029658519ENSE00001082060chr5:52368443-5236852583ITA2_HUMAN783-810280--
1.20ENST0000029658520ENSE00001082054chr5:52368948-52369089142ITA2_HUMAN810-857480--
1.21ENST0000029658521ENSE00001082080chr5:52370215-5237030793ITA2_HUMAN858-888310--
1.22ENST0000029658522ENSE00001082083chr5:52370891-5237096777ITA2_HUMAN889-914260--
1.23ENST0000029658523ENSE00001082056chr5:52371051-5237113484ITA2_HUMAN914-942290--
1.24ENST0000029658524ENSE00001082070chr5:52374602-52374704103ITA2_HUMAN942-976350--
1.25ENST0000029658525ENSE00001082068chr5:52376341-52376451111ITA2_HUMAN977-1013370--
1.26ENST0000029658526ENSE00001082079chr5:52377422-52377526105ITA2_HUMAN1014-1048350--
1.27ENST0000029658527ENSE00001082061chr5:52379170-52379283114ITA2_HUMAN1049-1086380--
1.28ENST0000029658528ENSE00001082057chr5:52382782-5238287190ITA2_HUMAN1087-1116300--
1.29ENST0000029658529ENSE00001082066chr5:52385776-52385892117ITA2_HUMAN1117-1155390--
1.30eENST0000029658530eENSE00001262757chr5:52386349-523906094261ITA2_HUMAN1156-1181260--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:134
 aligned with SLA_ECHML | Q7T2Q1 from UniProtKB/Swiss-Prot  Length:157

    Alignment length:134
                                    33        43        53        63        73        83        93       103       113       123       133       143       153    
            SLA_ECHML    24 DFDCPSDWTAYDQHCYLAIGEPQNWYEAERFCTEQAKDGHLVSIQSREEGNFVAQLVSGFMHRSEIYVWIGLRDRREEQQCNPEWNDGSKIIYVNWKEGESKMCQGLTKWTNFHDWNNINCEDLYPFVCKFSAV 157
               SCOP domains d1v7pa_ A: Snake coagglutinin alpha chain                                                                                              SCOP domains
               CATH domains 1v7pA00 A:1-134 Mannose-Binding Protein A, subunit A                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..eeeeeeeeeehhhhhhhhhhhhh...ee....hhhhhhhhhhhhhhhhhh...eeeeeee..............................eeeee.hhh...eeee.....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------C_TYPE_LECTIN_2  PDB: A:11-130 UniProt: 34-153                                                                          ---- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1v7p A   1 DFDCPSDWTAYDQHCYLAIGEPQNWYEAERFCTEQAKDGHLVSIQSREEGNFVAQLVSGFMHRSEIYVWIGLRDRREEQQCNPEWNDGSKIIYVNWKEGESKMCQGLTKWTNFHDWNNINCEDLYPFVCKFSAV 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    

Chain B from PDB  Type:PROTEIN  Length:127
 aligned with SLB_ECHML | Q7T2Q0 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:127
                                    36        46        56        66        76        86        96       106       116       126       136       146       
            SLB_ECHML    27 CPLGWSSFDQHCYKVFEPVKNWTEAEEICMQQHKGSRLASIHGSEEEAFVSKLASKALKFTSMWIGLNNPWKDCKWEWSDNARFDYKAWKRRPYCTVMVVKPDRIFWFTRGCEKSVSFVCKFLTDPA 153
               SCOP domains d1v7pb_ B: Snake coagglutinin beta chain                                                                                        SCOP domains
               CATH domains 1v7pB00 B:1-127 Mannose-Binding Protein A, subunit A                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eeeeeeeeeehhhhhhhhhhhhh...ee....hhhhhhhhhhhhhhhh...eeeeeee........ee...............eeeeeee....eeeeeee....eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------C_TYPE_LECTIN_2  PDB: B:8-121 UniProt: 34-147                                                                     ------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1v7p B   1 CPLGWSSFDQHCYKVFEPVKNWTEAEEICMQQHKGSRLASIHSSEEEAFVSKLASKALKFTSMWIGLNNPWKDCKWEWSDNARFDYKAWKRRPYCTVMVVKPDRIFWFTRGCEKSVSFVCKFLTDPA 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       

Chain C from PDB  Type:PROTEIN  Length:193
 aligned with ITA2_HUMAN | P17301 from UniProtKB/Swiss-Prot  Length:1181

    Alignment length:193
                                   181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   
           ITA2_HUMAN   172 LIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSI 364
               SCOP domains d1v7pc_ C: Integrin alpha2-beta1                                                                                                                                                                  SCOP domains
               CATH domains 1v7pC00 C:143-335  [code=3.40.50.410, no name defined]                                                                                                                                            CATH domains
               Pfam domains --VWA-1v7pC01 C:145-334                                                                                                                                                                         - Pfam domains
         Sec.struct. author .eeeeeeee......hhhhhhhhhhhhhhh.......eeeeeeee...eeeee......hhhhhhhhhhhh........hhhhhhhhhhhhh.hhhhh.....eeeeeeee.....hhhhhhhhhhhhhhh.eeeeeeeehhhhhhh...hhhhhhhhhhhh..hhhhheeee..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --VWFA  PDB: C:145-332 UniProt: 174-361                                                                                                                                                       --- PROSITE
           Transcript 1 (1) Exon 1.6  PDB: C:143-181 [INCOMPLETE]  Exon 1.7  PDB: C:182-231 UniProt: 211-260         --------------------------------------------------Exon 1.9  PDB: C:282-335 UniProt: 311-366 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------Exon 1.8  PDB: C:231-281 UniProt: 260-310          ------------------------------------------------------ Transcript 1 (2)
                 1v7p C 143 LIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSI 335
                                   152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: vWA-like (60)
(-)
Family: VWA (50)

(-) Gene Ontology  (74, 75)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (SLA_ECHML | Q7T2Q1)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B   (SLB_ECHML | Q7T2Q0)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain C   (ITA2_HUMAN | P17301)
molecular function
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0098639    collagen binding involved in cell-matrix adhesion    Any collagen binding that occurs as part of cell-matrix adhesion.
    GO:0038064    collagen receptor activity    Combining with a collagen and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005178    integrin binding    Interacting selectively and non-covalently with an integrin.
    GO:0043236    laminin binding    Interacting selectively and non-covalently with laminins, glycoproteins that are major constituents of the basement membrane of cells.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0033627    cell adhesion mediated by integrin    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via an integrin, a heterodimeric adhesion receptor formed by the non-covalent association of particular alpha and beta subunits.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0031589    cell-substrate adhesion    The attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0071392    cellular response to estradiol stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0071260    cellular response to mechanical stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
    GO:0071407    cellular response to organic cyclic compound    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0038065    collagen-activated signaling pathway    A series of molecular signals initiated by collagen binding to a cell surface receptor, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050966    detection of mechanical stimulus involved in sensory perception of pain    The series of events involved in the perception of pain in which a mechanical stimulus is received and converted into a molecular signal.
    GO:0045184    establishment of protein localization    The directed movement of a protein to a specific location.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0007565    female pregnancy    The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
    GO:0048041    focal adhesion assembly    The aggregation and bonding together of a set of components to form a focal adhesion, a complex of intracellular signaling and structural proteins that provides a structural link between the internal actin cytoskeleton and the ECM, and also function as a locus of signal transduction activity.
    GO:0070365    hepatocyte differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a hepatocyte. A hepatocyte is specialized epithelial cell that is organized into interconnected plates called lobules, and is the main structural component of the liver.
    GO:0006971    hypotonic response    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of detection of, or exposure to, a hypotonic environment, i.e. an environment with a lower concentration of solutes than the organism or cell.
    GO:0007229    integrin-mediated signaling pathway    A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0030879    mammary gland development    The process whose specific outcome is the progression of the mammary gland over time, from its formation to the mature structure. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk. Its development starts with the formation of the mammary line and ends as the mature gland cycles between nursing and weaning stages.
    GO:0048333    mesodermal cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a mesoderm cell.
    GO:0043388    positive regulation of DNA binding    Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0010694    positive regulation of alkaline phosphatase activity    Any process that increases the frequency, rate or extent of alkaline phosphatase activity, the catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an alkaline pH optimum.
    GO:0045785    positive regulation of cell adhesion    Any process that activates or increases the frequency, rate or extent of cell adhesion.
    GO:0031346    positive regulation of cell projection organization    Any process that activates or increases the frequency, rate or extent of the process involved in the formation, arrangement of constituent parts, or disassembly of cell projections.
    GO:0033343    positive regulation of collagen binding    Any process that activates or increases the frequency, rate or extent of collagen binding.
    GO:0032967    positive regulation of collagen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals.
    GO:0010634    positive regulation of epithelial cell migration    Any process that activates or increases the frequency, rate or extent of epithelial cell migration.
    GO:0050729    positive regulation of inflammatory response    Any process that activates or increases the frequency, rate or extent of the inflammatory response.
    GO:0002687    positive regulation of leukocyte migration    Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
    GO:0060100    positive regulation of phagocytosis, engulfment    Any process that activates or increases the frequency, rate or extent of the internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis.
    GO:0050927    positive regulation of positive chemotaxis    Any process that activates or increases the frequency, rate or extent of the directed movement of a motile cell or organism towards a higher concentration in a concentration gradient of a specific chemical.
    GO:0014911    positive regulation of smooth muscle cell migration    Any process that activates, maintains or increases the frequency, rate or extent of smooth muscle cell migration.
    GO:0048661    positive regulation of smooth muscle cell proliferation    Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
    GO:0045987    positive regulation of smooth muscle contraction    Any process that activates or increases the frequency, rate or extent of smooth muscle contraction.
    GO:0045727    positive regulation of translation    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0051971    positive regulation of transmission of nerve impulse    Any process that activates, maintains or increases the frequency, rate or extent of transmission of a nerve impulse, the sequential electrochemical polarization and depolarization that travels across the membrane of a neuron in response to stimulation.
    GO:0033591    response to L-ascorbic acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an L-ascorbic acid (vitamin C) stimulus.
    GO:0014075    response to amine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amine stimulus. An amine is a compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0014850    response to muscle activity    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a muscle activity stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0071107    response to parathyroid hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a parathyroid hormone stimulus.
    GO:0043589    skin morphogenesis    The process in which the anatomical structures of the skin are generated and organized. The skin is the external membranous integument of an animal. In vertebrates the skin generally consists of two layers, an outer nonsensitive and nonvascular epidermis (cuticle or skarfskin) composed of cells which are constantly growing and multiplying in the deeper, and being thrown off in the superficial layers, as well as an inner, sensitive and vascular dermis (cutis, corium or true skin) composed mostly of connective tissue.
    GO:0006929    substrate-dependent cell migration    The orderly movement of a cell from one site to another along a substrate such as the extracellular matrix; the migrating cell forms a protrusion that attaches to the substrate.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0043679    axon terminus    Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal button is a specialized region of it.
    GO:0045178    basal part of cell    The region of a cell situated near the base. For example, in a polarized epithelial cell, the basal surface rests on the basal lamina that separates the epithelium from other tissue.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0034666    integrin alpha2-beta1 complex    An integrin complex that comprises one alpha2 subunit and one beta1 subunit.
    GO:0008305    integrin complex    A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile C:306 - Pro C:307   [ RasMol ]  
    Tyr C:157 - Pro C:158   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v7p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITA2_HUMAN | P17301
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SLA_ECHML | Q7T2Q1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SLB_ECHML | Q7T2Q0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ITA2_HUMAN | P17301
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SLA_ECHML | Q7T2Q1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SLB_ECHML | Q7T2Q0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITA2_HUMAN | P173011aox 1dzi 1pqb 4bj3 5hj2
        SLA_ECHML | Q7T2Q11ukm
        SLB_ECHML | Q7T2Q01ukm

(-) Related Entries Specified in the PDB File

1aox UNCOMPLEXED ALPHA2-I DOMAIN
1dzi ALPHA2-I DOMAIN IN COMPLEX WITH COLLAGEN LIKE PEPTIDE
1ukm UNCOMPLEXED EMS16