Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF COLD-ACTIVE PROTEIN-TYROSINE PHOSPHATASE OF A PSYCHROPHILE SHEWANELLA SP.
 
Authors :  H. Tsuruta, B. Mikami, Y. Aizono
Date :  09 Dec 03  (Deposition) - 01 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.82
Chains :  Asym./Biol. Unit :  A
Keywords :  Cold-Active Enzyme, Psychrophile, Protein-Tyrosine Phosphatase, Shewanella Sp, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Tsuruta, B. Mikami, Y. Aizono
Crystal Structure Of Cold-Active Protein-Tyrosine Phosphatase From A Psychrophile, Shewanella Sp
J. Biochem. (Tokyo) V. 137 69 2005
PubMed-ID: 15713885  |  Reference-DOI: 10.1093/JB/MVI010
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PSYCHROPHILIC PHOSPHATASE I
    ChainsA
    EC Number3.1.3.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET22B
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificSHEWANELLA SP.
    Organism Taxid50422
    SynonymPROTEIN-TYROSINE-PHOSPHATASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1ACY1Ligand/IonACETIC ACID
2CA2Ligand/IonCALCIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:78 , HIS A:80 , ASP A:114 , HOH A:772 , HOH A:774 , ACY A:1001 , CA A:2002BINDING SITE FOR RESIDUE CA A 2001
2AC2SOFTWAREASP A:114 , ASN A:149 , HIS A:207 , HIS A:286 , HOH A:774 , ACY A:1001 , CA A:2001BINDING SITE FOR RESIDUE CA A 2002
3AC3SOFTWAREHIS A:80 , ASP A:114 , ARG A:118 , ASN A:149 , HIS A:150 , ARG A:258 , HIS A:286 , HOH A:758 , HOH A:774 , CA A:2001 , CA A:2002BINDING SITE FOR RESIDUE ACY A 1001

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:27 -A:47

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:10 -Pro A:11

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V73)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1V73)

(-) Exons   (0, 0)

(no "Exon" information available for 1V73)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:331
 aligned with Q9S427_9GAMM | Q9S427 from UniProtKB/TrEMBL  Length:361

    Alignment length:331
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354 
         Q9S427_9GAMM    25 TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ 355
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------------------------------------------------------Metallophos-1v73A01 A:71-290                                                                                                                                                                                                ---------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.......eeeeee..eeeeee....ee...........ee..hhhhh....ee....eeeee.....hhhhhhhhhhhh..............eeee.........hhhhhhhhhhhhhhhhhhh..eeee..hhhhhhhhhh.....hhhhhhhhhhh..hhhhhhh..hhhhhhhh....eeee..eeee.....hhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.......hhhhh...hhhhhhhhhhhhh..eeee........eee....eee...hhhhh....eeeee..eeeee.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1v73 A   6 TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ 336
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1V73)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1V73)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q9S427_9GAMM | Q9S427)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004725    protein tyrosine phosphatase activity    Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
    GO:0035335    peptidyl-tyrosine dephosphorylation    The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:10 - Pro A:11   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v73
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9S427_9GAMM | Q9S427
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9S427_9GAMM | Q9S427
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9S427_9GAMM | Q9S4272z72 2zbm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1V73)