|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1UXC) |
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1UXC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UXC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UXC) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1UXC) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:50 aligned with CRA_ECOLI | P0ACP1 from UniProtKB/Swiss-Prot Length:334 Alignment length:50 10 20 30 40 50 CRA_ECOLI 1 MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN 50 SCOP domains d1uxca_ A: SCOP domains CATH domains 1uxcA00 A:1-50 CATH domains Pfam domains -------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LACI_2 PDB: A:1-50 UniProt: 1-58 PROSITE (1) PROSITE (2) --HTH_LACI_1 ----------------------------- PROSITE (2) Transcript -------------------------------------------------- Transcript 1uxc A 1 MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN 50 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1UXC) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (CRA_ECOLI | P0ACP1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|