Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  FRUCTOSE REPRESSOR DNA-BINDING DOMAIN, NMR, MINIMIZED STRUCTURE
 
Authors :  F. Penin, C. Geourjon, R. Montserret, A. Bockmann, A. Lesage, Y. Yang, C Bidaud, J. C. Cortay, D. Negre, A. J. Cozzone, G. Deleage
Date :  26 Dec 96  (Deposition) - 21 Apr 97  (Release) - 13 Jul 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
NMR Structure *:  A  (1x)
Keywords :  Dna-Binding Protein, Fructose Repressor, Laci Family, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Penin, C. Geourjon, R. Montserret, A. Bockmann, A. Lesage, Y. S. Yang, C. Bonod-Bidaud, J. C. Cortay, D. Negre, A. J. Cozzone, G. Deleage
Three-Dimensional Structure Of The Dna-Binding Domain Of Th Fructose Repressor From Escherichia Coli By 1H And 15N Nmr.
J. Mol. Biol. V. 270 496 1997
PubMed-ID: 9237914  |  Reference-DOI: 10.1006/JMBI.1997.1123
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FRUCTOSE REPRESSOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneFRUR1
    Expression System PlasmidPCB4
    Expression System Taxid562
    FragmentDNA-BINDING DOMAIN, RESIDUES 1 - 57, WITH LQHHHHHH ADDED AT C-TERMINUS
    MutationYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    Other DetailsOVERPRODUCED IN FUSION WITH A LQHHHHHH SEQUENCE AT C- TERMINAL END, RESIDUES 58 - 65
    StrainK12
    SynonymFRUR (1-57)
    VariantK12

 Structural Features

(-) Chains, Units

  1
NMR Structure A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UXC)

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1HTHUNKNOWNLEU A:3 , ASP A:4 , GLU A:5 , ILE A:6 , ALA A:7 , ARG A:8 , LEU A:9 , ALA A:10 , GLY A:11 , VAL A:12 , SER A:13 , ARG A:14 , THR A:15 , THR A:16 , ALA A:17 , SER A:18 , TYR A:19 , VAL A:20 , ILE A:21 , ASN A:22HTH_LACI FAMILY.

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UXC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UXC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UXC)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_LACI_2PS50932 LacI-type HTH domain profile.CRA_ECOLI1-58  1A:1-50
2HTH_LACI_1PS00356 LacI-type HTH domain signature.CRA_ECOLI3-21  1A:3-21
NMR Structure * (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_LACI_2PS50932 LacI-type HTH domain profile.CRA_ECOLI1-58  1A:1-50
2HTH_LACI_1PS00356 LacI-type HTH domain signature.CRA_ECOLI3-21  1A:3-21

(-) Exons   (0, 0)

(no "Exon" information available for 1UXC)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:50
 aligned with CRA_ECOLI | P0ACP1 from UniProtKB/Swiss-Prot  Length:334

    Alignment length:50
                                    10        20        30        40        50
             CRA_ECOLI    1 MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN 50
               SCOP domains d1uxca_ A:                                         SCOP domains
               CATH domains 1uxcA00 A:1-50                                     CATH domains
               Pfam domains -------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh...hhhhhhhhh..........hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------- SAPs(SNPs)
                PROSITE (1) HTH_LACI_2  PDB: A:1-50 UniProt: 1-58              PROSITE (1)
                PROSITE (2) --HTH_LACI_1         ----------------------------- PROSITE (2)
                 Transcript -------------------------------------------------- Transcript
                  1uxc A  1 MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN 50
                                    10        20        30        40        50

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1UXC)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (CRA_ECOLI | P0ACP1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0009750    response to fructose    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fructose stimulus.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1uxc)
 
  Sites
    HTH  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uxc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1uxc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CRA_ECOLI | P0ACP1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CRA_ECOLI | P0ACP1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CRA_ECOLI | P0ACP11uxd 2iks

(-) Related Entries Specified in the PDB File

1uxd